SMARCD2 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257074-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP257074 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
SMARCD2
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
60 kDa BRG-1/Brm-associated factor subunit B, BAF60B, BRG1-associated factor 60B, chromatin remodeling complex BAF60B subunit, CRACD2, mammalian chromatin remodeling complex BRG1-associated factor 60B, PRO2451, Rsc6p, SWI/SNF complex 60 kDa subunit B, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2, Swp73-like protein
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
SMARCD2
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QYQRPGMSPGNRMPMAGLQVGPPAGSPFGAAAPLRPGMPPTMMDPFRKRLLVPQAQPPMPAQ
Quantity
100 μL
Research Discipline
Chromatin Research
Gene ID (Entrez)
6603
Target Species
Human
Isotype
IgG
Related Products
Description
- SMARCD2 Polyclonal specifically detects SMARCD2 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: SMARCD2
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: 60 kDa BRG-1/Brm-associated factor subunit B, BAF60B, BRG1-associated factor 60B, chromatin remodeling complex BAF60B subunit, CRACD2, mammalian chromatin remodeling complex BRG1-associated factor 60B, PRO2451, Rsc6p, SWI/SNF complex 60 kDa subunit B, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2, Swp73-like protein
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: SMARCD2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QYQRPGMSPGNRMPMAGLQVGPPAGSPFGAAAPLRPGMPPTMMDPFRKRLLVPQAQPPMPAQ
Quantity: 100 μL
Research Discipline: Chromatin Research
Gene ID (Entrez): 6603
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: 60 kDa BRG-1/Brm-associated factor subunit B, BAF60B, BRG1-associated factor 60B, chromatin remodeling complex BAF60B subunit, CRACD2, mammalian chromatin remodeling complex BRG1-associated factor 60B, PRO2451, Rsc6p, SWI/SNF complex 60 kDa subunit B, SWI
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 6603
Target Species: __
Isotype: __
Antigen: __
Classification: __
Dilution: __
Gene Alias: C/EBP beta, C/EBP-beta, CCAAT/enhancer binding protein (C/EBP), beta, CCAAT/enhancer-binding protein beta, CRP2, IL6DBP, interleukin 6-dependent DNA-binding protein, LAPTCF-5, Liver activator protein, liver-enriched transcriptional activator protein, MGC3
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 1051
Target Species: __
Isotype: __