BMI-1 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257552-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP257552 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
BMI-1
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
B lymphoma Mo-MLV insertion region 1 homolog, B lymphoma Mo-MLV insertion region 1 homolog (mouse), BMI1 polycomb ring finger oncogene, FLVI2/BMI1, MGC12685, murine leukemia viral (bmi-1) oncogene homolog, PCGF4, polycomb complex protein BMI-1, polycomb group protein Bmi1, polycomb group ring finger 4, RING finger protein 51, RNF51Polycomb group RING finger protein 4
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
BMI1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYE
Quantity
100 μL
Research Discipline
Breast Cancer, Cancer, Cancer Stem Cells, Cell Biology, Cell Cycle and Replication, Chromatin Research, DNA Repair, DNA replication Transcription Translation and Splicing, Epigenetics, Hematopoietic Stem Cell Markers, Neuronal Stem Cell Markers, Stem Cell Markers, Transcription Factors and Regulators
Gene ID (Entrez)
648
Target Species
Human
Isotype
IgG
Related Products
Description
- BMI-1 Polyclonal specifically detects BMI-1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: BMI-1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: B lymphoma Mo-MLV insertion region 1 homolog, B lymphoma Mo-MLV insertion region 1 homolog (mouse), BMI1 polycomb ring finger oncogene, FLVI2/BMI1, MGC12685, murine leukemia viral (bmi-1) oncogene homolog, PCGF4, polycomb complex protein BMI-1, polycomb group protein Bmi1, polycomb group ring finger 4, RING finger protein 51, RNF51Polycomb group RING finger protein 4
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: BMI1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYE
Quantity: 100 μL
Research Discipline: Breast Cancer, Cancer, Cancer Stem Cells, Cell Biology, Cell Cycle and Replication, Chromatin Research, DNA Repair, DNA replication Transcription Translation and Splicing, Epigenetics, Hematopoietic Stem Cell Markers, Neuronal Stem Cell Markers, Stem Cell Markers, Transcription Factors and Regulators
Gene ID (Entrez): 648
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: B lymphoma Mo-MLV insertion region 1 homolog, B lymphoma Mo-MLV insertion region 1 homolog (mouse), BMI1 polycomb ring finger oncogene, FLVI2/BMI1, MGC12685, murine leukemia viral (bmi-1) oncogene homolog, PCGF4, polycomb complex protein BMI-1, polycomb g
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 648
Target Species: __
Isotype: __
Antigen: TNPO2
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: FLJ12155, IPO3, Karyopherin beta-2b, KPNB2Bimportin 3, transportin 2, transportin 2 (importin 3, karyopherin beta 2b), transportin-2, TRN2karyopherin beta 2b, transportin
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: TNPO2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QDIKPRFHKSRTVTLPHEAERPDGSEDAEDDDD
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 30000
Target Species: Human
Isotype: IgG