Corin Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
Corin
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
atrial natriuteric peptide-converting enzyme, Corin, corin, serine peptidase, EC 3.4.21, EC 3.4.21.-, heart specific serine proteinase, Heart-specific serine proteinase ATC2, MGC119742, pro-ANP-convertase, Pro-ANP-converting enzyme, PRSC, serine protease, Transmembrane protease serine 10
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
10699
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
CORIN
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NVNSSSFLMVHRAATEHHVCADGWQEILSQLACKQMGLGEPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQ
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Corin Polyclonal specifically detects Corin in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: Corin
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: atrial natriuteric peptide-converting enzyme, Corin, corin, serine peptidase, EC 3.4.21, EC 3.4.21.-, heart specific serine proteinase, Heart-specific serine proteinase ATC2, MGC119742, pro-ANP-convertase, Pro-ANP-converting enzyme, PRSC, serine protease, Transmembrane protease serine 10
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 10699
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: CORIN
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NVNSSSFLMVHRAATEHHVCADGWQEILSQLACKQMGLGEPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQ
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: atrial natriuteric peptide-converting enzyme, Corin, corin, serine peptidase, EC 3.4.21, EC 3.4.21.-, heart specific serine proteinase, Heart-specific serine proteinase ATC2, MGC119742, pro-ANP-convertase, Pro-ANP-converting enzyme, PRSC, serine protease,
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 10699
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
Antigen: MTMR9
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: DKFZp434K171, LIP-STYX, MGC126672, MTMR8C8orf9, myotubularin related protein 8, myotubularin related protein 9, myotubularin-related protein 9
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 66036
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: MTMR9
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LSTLDSITLMYPFFYRPMFEVIEDGWHSFLPEQEFELYSSATSEWRLSYVNKEFAVCPSYPPIVTVPKSIDDEALRKV
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.