TRAILR4/TNFRSF10D/DcR2 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257993-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP257993 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
TRAILR4/TNFRSF10D/DcR2
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
CD264, CD264 antigen, DcR2, DCR2decoy with truncated death domain, Decoy receptor 2, TNF receptor-related receptor for TRAIL, TNF-related apoptosis-inducing ligand receptor 4, TRAIL-R4, TRAILR4TRAIL receptor 4, TRUNDDTRAIL receptor with a truncated death domain, tumor necrosis factor receptor superfamily member 10D, tumor necrosis factor receptor superfamily, member 10d, decoy with truncateddeath domain
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
TNFRSF10D
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LLVPVNDADSADISTLLDASATLEEGHAKETI
Quantity
100 μL
Research Discipline
Apoptosis, Cancer, Cell Biology, Cytokine Research, Immunology, Innate Immunity
Gene ID (Entrez)
8793
Target Species
Human
Isotype
IgG
Related Products
Description
- TRAILR4/TNFRSF10D/DcR2 Polyclonal specifically detects TRAILR4/TNFRSF10D/DcR2 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: TRAILR4/TNFRSF10D/DcR2
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: CD264, CD264 antigen, DcR2, DCR2decoy with truncated death domain, Decoy receptor 2, TNF receptor-related receptor for TRAIL, TNF-related apoptosis-inducing ligand receptor 4, TRAIL-R4, TRAILR4TRAIL receptor 4, TRUNDDTRAIL receptor with a truncated death domain, tumor necrosis factor receptor superfamily member 10D, tumor necrosis factor receptor superfamily, member 10d, decoy with truncateddeath domain
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: TNFRSF10D
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LLVPVNDADSADISTLLDASATLEEGHAKETI
Quantity: 100 μL
Research Discipline: Apoptosis, Cancer, Cell Biology, Cytokine Research, Immunology, Innate Immunity
Gene ID (Entrez): 8793
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: CD264, CD264 antigen, DcR2, DCR2decoy with truncated death domain, Decoy receptor 2, TNF receptor-related receptor for TRAIL, TNF-related apoptosis-inducing ligand receptor 4, TRAIL-R4, TRAILR4TRAIL receptor 4, TRUNDDTRAIL receptor with a truncated death
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 8793
Target Species: __
Isotype: __
Antigen: Citron Kinase
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: CITK, citron (rho-interacting, serine/threonine kinase 21), Citron Rho-Interacting Kinase, Citron Rho-Interacting Serine/Threonine Kinase, CRIK, KIAA0949, MCPH17, Rho-interacting Serine/Threonine kinase 21, serine/threonine kinase 21, Serine/threonine-protein kinase 21, STK21
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: CIT
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ERSDLEYQLENIQVLYSHEKVKMEGTISQQTKLIDFLQAKMDQPAKKKKGLFSRRKEDPALPTQVPLQYNELKLALEKEKARCA
Quantity: 100 μL
Research Discipline: Protein Kinase
Gene ID (Entrez): 11113
Target Species: Human
Isotype: IgG