NBP258040

BTG4 Antibody, Novus Biologicals™

Manufacturer: Fischer Scientific

Select a Size

Pack Size SKU Availability Price
Each of 1 NBP258040-Each-of-1 In Stock ₹ 53,688.90

NBP258040 - Each of 1

₹ 53,688.90

In Stock

Quantity

1

Base Price: ₹ 53,688.90

GST (18%): ₹ 9,664.002

Total Price: ₹ 63,352.902

Antigen

BTG4

Classification

Polyclonal

Dilution

Immunocytochemistry/Immunofluorescence 1-4 ug/ml

Gene Alias

B-cell translocation gene 4, BTG family member 4, MGC33003, PC3BProtein PC3b, protein BTG4

Host Species

Rabbit

Purification Method

Affinity Purified

Regulatory Status

RUO

Primary or Secondary

Primary

Test Specificity

Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Content And Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Applications

Immunocytochemistry, Immunofluorescence

Conjugate

Unconjugated

Formulation

PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide

Gene Symbols

BTG4

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GQAFRCIRINNNQNKDPILERACVESNVDFSHLGLPKEMTIWVDPFE

Quantity

100 μL

Research Discipline

Cell Cycle and Replication

Gene ID (Entrez)

54766

Target Species

Human

Isotype

IgG

Related Products

Img

Fischer Scientific

NB393363

--

Img

Fischer Scientific

NB393546

--

Img

Fischer Scientific

NBP258057

--

Img

Fischer Scientific

NBP232518

--

Img

Fischer Scientific

NB393637

--

Img

Fischer Scientific

NB431037

--

Img

Fischer Scientific

200045531

Rabbit Polyclonal Antibody...

Img

Fischer Scientific

200045367

Rabbit Polyclonal Antibody...

Description

  • BTG4 Polyclonal specifically detects BTG4 in Human samples
  • It is validated for Immunocytochemistry/Immunofluorescence.

Compare Similar Items

Show Difference

Img

Fischer Scientific

NBP258040

--


Antigen:
BTG4

Classification:
Polyclonal

Dilution:
Immunocytochemistry/Immunofluorescence 1-4 ug/ml

Gene Alias:
B-cell translocation gene 4, BTG family member 4, MGC33003, PC3BProtein PC3b, protein BTG4

Host Species:
Rabbit

Purification Method:
Affinity Purified

Regulatory Status:
RUO

Primary or Secondary:
Primary

Test Specificity:
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Applications:
Immunocytochemistry, Immunofluorescence

Conjugate:
Unconjugated

Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide

Gene Symbols:
BTG4

Immunogen:
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GQAFRCIRINNNQNKDPILERACVESNVDFSHLGLPKEMTIWVDPFE

Quantity:
100 μL

Research Discipline:
Cell Cycle and Replication

Gene ID (Entrez):
54766

Target Species:
Human

Isotype:
IgG

Img

Novus Biologicals™

NBP258040PE

--


Antigen:
__

Classification:
__

Dilution:
__

Gene Alias:
B-cell translocation gene 4, BTG family member 4, MGC33003, PC3BProtein PC3b, protein BTG4

Host Species:
__

Purification Method:
>80% by SDS-PAGE and Coomassie blue staining

Regulatory Status:
RUO

Primary or Secondary:
__

Test Specificity:
__

Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.

Applications:
__

Conjugate:
__

Formulation:
PBS and 1M Urea, pH 7.4.

Gene Symbols:
__

Immunogen:
__

Quantity:
100μL

Research Discipline:
__

Gene ID (Entrez):
54766

Target Species:
__

Isotype:
__

Img

Fischer Scientific

NBP258042

--


Antigen:
Fascin

Classification:
Polyclonal

Dilution:
Immunohistochemistry-Paraffin 1:20 - 1:50

Gene Alias:
FAN1,55 kDa actin-bundling protein, fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus), FLJ38511, HSN, p55actin bundling protein, singed (Drosophila)-like (sea urchin fascin homolog like), singed-like (fascin homolog, sea urchin), Singed-like protein, SNLfascin

Host Species:
Rabbit

Purification Method:
Affinity Purified

Regulatory Status:
RUO

Primary or Secondary:
Primary

Test Specificity:
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Applications:
Immunohistochemistry (Paraffin)

Conjugate:
Unconjugated

Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide

Gene Symbols:
FSCN1

Immunogen:
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GEHGFIGCRKVTGTLDANRSSYDVFQLEFNDGAYNIKDSTGKYWTVGSDSAVTSSGDTPVDFFFEFCDYNKVAIKVGGRYLKGDHAGVLKASAETVDP

Quantity:
100 μL

Research Discipline:
Cytoskeleton Markers

Gene ID (Entrez):
6624

Target Species:
Human

Isotype:
IgG

Img

Novus Biologicals™

NBP258042PE

--


Antigen:
__

Classification:
__

Dilution:
__

Gene Alias:
FAN1,55 kDa actin-bundling protein, fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus), FLJ38511, HSN, p55actin bundling protein, singed (Drosophila)-like (sea urchin fascin homolog like), singed-like (fascin homolog, sea urchin), Si

Host Species:
__

Purification Method:
>80% by SDS-PAGE and Coomassie blue staining

Regulatory Status:
RUO

Primary or Secondary:
__

Test Specificity:
__

Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.

Applications:
__

Conjugate:
__

Formulation:
PBS and 1M Urea, pH 7.4.

Gene Symbols:
__

Immunogen:
__

Quantity:
100μL

Research Discipline:
__

Gene ID (Entrez):
6624

Target Species:
__

Isotype:
__