ALG12 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258353-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP258353 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
ALG12
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
alpha-1,6-mannosyltransferase), asparagine-linked glycosylation 12 homolog (S. cerevisiae, asparagine-linked glycosylation 12 homolog (yeast, asparagine-linked glycosylation 12, alpha-1,6-mannosyltransferase homolog (S.cerevisiae), Asparagine-linked glycosylation protein 12 homolog, CDG1G, dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6-mannosyltransferase, dolichyl-P-mannose:Man-7-GlcNAc-2-PP-dolichyl-alpha-6-mannosyltransferase, EC 2.4.1.-, ECM39, hALG12, Mannosyltransferase ALG12 homolog, Membrane protein SB87, MGC111358, MGC3136, PP14673
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
79087
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
ALG12
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KVEESFNLQATHDLLYHWQDLEQYDHLEF
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- ALG12 Polyclonal specifically detects ALG12 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: ALG12
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: alpha-1,6-mannosyltransferase), asparagine-linked glycosylation 12 homolog (S. cerevisiae, asparagine-linked glycosylation 12 homolog (yeast, asparagine-linked glycosylation 12, alpha-1,6-mannosyltransferase homolog (S.cerevisiae), Asparagine-linked glycosylation protein 12 homolog, CDG1G, dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6-mannosyltransferase, dolichyl-P-mannose:Man-7-GlcNAc-2-PP-dolichyl-alpha-6-mannosyltransferase, EC 2.4.1.-, ECM39, hALG12, Mannosyltransferase ALG12 homolog, Membrane protein SB87, MGC111358, MGC3136, PP14673
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 79087
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: ALG12
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KVEESFNLQATHDLLYHWQDLEQYDHLEF
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: alpha-1,6-mannosyltransferase), asparagine-linked glycosylation 12 homolog (S. cerevisiae, asparagine-linked glycosylation 12 homolog (yeast, asparagine-linked glycosylation 12, alpha-1,6-mannosyltransferase homolog (S.cerevisiae), Asparagine-linked glyco
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 79087
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Antigen: MCAT
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: EC 2.3.1.39, fabD, FASN2C, malonyl CoA:ACP acyltransferase (mitochondrial), malonyl-CoA:acyl carrier protein transacylase, mitochondrial, malonyl-CoA-acyl carrier protein transacylase, mitochondrial, MCT[Acyl-carrier-protein] malonyltransferase, Mitochondrial malonyltransferase, MTMGC47838, NET62
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 27349
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: MCAT
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MPGQCSVLLFPGQGSQVVGMGRGLLNYPRVRELYAAARRVLGYDLLELSLHGPQETLDRTVHCQPAIFVASLAAVEKLHHLQPSVIENCVAAAGFSVGEFAALVFAGAMEFAE
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.