NBP258536

DNAH11 Antibody, Novus Biologicals™

Manufacturer: Novus Biologicals

Select a Size

Pack Size SKU Availability Price
Each of 1 NBP258536-Each-of-1 In Stock ₹ 55,271.76

NBP258536 - Each of 1

₹ 55,271.76

In Stock

Quantity

1

Base Price: ₹ 55,271.76

GST (18%): ₹ 9,948.917

Total Price: ₹ 65,220.677

Antigen

DNAH11

Classification

Polyclonal

Dilution

Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500

Gene Alias

axonemal, Axonemal beta dynein heavy chain 11, CILD7Dnahc11, Ciliary dynein heavy chain 11, DNAHBLFLJ30095, DNAHC11FLJ37699, DNHBL, dynein, axonemal, heavy chain 11, dynein, axonemal, heavy polypeptide 11, dynein, ciliary, heavy chain 11

Host Species

Rabbit

Purification Method

Affinity Purified

Regulatory Status

RUO

Gene ID (Entrez)

8701

Target Species

Human

Isotype

IgG

Applications

Immunohistochemistry (Paraffin)

Conjugate

Unconjugated

Formulation

PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide

Gene Symbols

DNAH11

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DCWGYIERVRAATSELEHRVERTQKNVKVIQQTMRGWARCVLPPRREHRREAAFTLEDKGDLFTKKYKLIQGDGCKIHNLVEENRKLFKANPSLDTWKI

Quantity

100 μL

Primary or Secondary

Primary

Test Specificity

Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Content And Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Description

  • DNAH11 Polyclonal specifically detects DNAH11 in Human samples
  • It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Compare Similar Items

Show Difference

Img

Novus Biologicals

NBP258536

--


Antigen:
DNAH11

Classification:
Polyclonal

Dilution:
Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500

Gene Alias:
axonemal, Axonemal beta dynein heavy chain 11, CILD7Dnahc11, Ciliary dynein heavy chain 11, DNAHBLFLJ30095, DNAHC11FLJ37699, DNHBL, dynein, axonemal, heavy chain 11, dynein, axonemal, heavy polypeptide 11, dynein, ciliary, heavy chain 11

Host Species:
Rabbit

Purification Method:
Affinity Purified

Regulatory Status:
RUO

Gene ID (Entrez):
8701

Target Species:
Human

Isotype:
IgG

Applications:
Immunohistochemistry (Paraffin)

Conjugate:
Unconjugated

Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide

Gene Symbols:
DNAH11

Immunogen:
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DCWGYIERVRAATSELEHRVERTQKNVKVIQQTMRGWARCVLPPRREHRREAAFTLEDKGDLFTKKYKLIQGDGCKIHNLVEENRKLFKANPSLDTWKI

Quantity:
100 μL

Primary or Secondary:
Primary

Test Specificity:
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Img

Novus Biologicals™

NBP258536PE

--


Antigen:
__

Classification:
__

Dilution:
__

Gene Alias:
axonemal, Axonemal beta dynein heavy chain 11, CILD7Dnahc11, Ciliary dynein heavy chain 11, DNAHBLFLJ30095, DNAHC11FLJ37699, DNHBL, dynein, axonemal, heavy chain 11, dynein, axonemal, heavy polypeptide 11, dynein, ciliary, heavy chain 11

Host Species:
__

Purification Method:
>80% by SDS-PAGE and Coomassie blue staining

Regulatory Status:
RUO

Gene ID (Entrez):
8701

Target Species:
__

Isotype:
__

Applications:
__

Conjugate:
__

Formulation:
PBS and 1M Urea, pH 7.4.

Gene Symbols:
__

Immunogen:
__

Quantity:
100μL

Primary or Secondary:
__

Test Specificity:
__

Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.

Img

Fischer Scientific

NBP258537

--


Antigen:
PFKP

Classification:
Polyclonal

Dilution:
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml

Gene Alias:
6-phosphofructokinase type C, 6-phosphofructokinase, platelet type, EC 2.7.1, EC 2.7.1.11, PFK-CFLJ40226, PFKFplatelet type, Phosphofructokinase 1, phosphofructokinase, platelet, Phosphohexokinase

Host Species:
Rabbit

Purification Method:
Affinity Purified

Regulatory Status:
RUO

Gene ID (Entrez):
5214

Target Species:
Human

Isotype:
IgG

Applications:
Western Blot, Immunocytochemistry, Immunofluorescence

Conjugate:
Unconjugated

Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide

Gene Symbols:
PFKP

Immunogen:
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MECVQMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINV

Quantity:
100 μL

Primary or Secondary:
Primary

Test Specificity:
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Img

Novus Biologicals™

NBP258537PE

--


Antigen:
__

Classification:
__

Dilution:
__

Gene Alias:
6-phosphofructokinase type C, 6-phosphofructokinase, platelet type, EC 2.7.1, EC 2.7.1.11, PFK-CFLJ40226, PFKFplatelet type, Phosphofructokinase 1, phosphofructokinase, platelet, Phosphohexokinase

Host Species:
__

Purification Method:
>80% by SDS-PAGE and Coomassie blue staining

Regulatory Status:
RUO

Gene ID (Entrez):
5214

Target Species:
__

Isotype:
__

Applications:
__

Conjugate:
__

Formulation:
PBS and 1M Urea, pH 7.4.

Gene Symbols:
__

Immunogen:
__

Quantity:
100μL

Primary or Secondary:
__

Test Specificity:
__

Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.