NBP258537PE
Novus Biologicals™ PFKP Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258537PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP258537PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
5214
Common Name
PFKP Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
6-phosphofructokinase type C, 6-phosphofructokinase, platelet type, EC 2.7.1, EC 2.7.1.11, PFK-CFLJ40226, PFKFplatelet type, Phosphofructokinase 1, phosphofructokinase, platelet, Phosphohexokinase
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
PFKP
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50326. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PFKP
- Source: E.coli Amino Acid Sequence: MECVQMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINV The PFKP Recombinant Protein Antigen is derived from E
- coli
- The PFKP Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 5214
Common Name: PFKP Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: 6-phosphofructokinase type C, 6-phosphofructokinase, platelet type, EC 2.7.1, EC 2.7.1.11, PFK-CFLJ40226, PFKFplatelet type, Phosphofructokinase 1, phosphofructokinase, platelet, Phosphohexokinase
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PFKP
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50326. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
5214
Common Name:
PFKP Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
6-phosphofructokinase type C, 6-phosphofructokinase, platelet type, EC 2.7.1, EC 2.7.1.11, PFK-CFLJ40226, PFKFplatelet type, Phosphofructokinase 1, phosphofructokinase, platelet, Phosphohexokinase
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PFKP
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50326. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 6732
Common Name: SRPK1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: EC 2.7.11.1, Serine/arginine-rich protein-specific kinase 1, serine/arginine-rich splicing factor kinase 1, serine/threonine-protein kinase SRPK1, SFRS protein kinase 1SFRSK1, SR protein kinase 1, SR-protein-specific kinase 1, SRSF protein kinase 1
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SRPK1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50327. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
6732
Common Name:
SRPK1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
EC 2.7.11.1, Serine/arginine-rich protein-specific kinase 1, serine/arginine-rich splicing factor kinase 1, serine/threonine-protein kinase SRPK1, SFRS protein kinase 1SFRSK1, SR protein kinase 1, SR-protein-specific kinase 1, SRSF protein kinase 1
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SRPK1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50327. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 4205
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: ADCAD1, MADS box transcription enhancer factor 2, polypeptide A (myocyte enhancerfactor 2A), MEF2, myocyte enhancer factor 2A, myocyte-specific enhancer factor 2A, RSRFC4, RSRFC9, Serum response factor-like protein 1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
4205
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
ADCAD1, MADS box transcription enhancer factor 2, polypeptide A (myocyte enhancerfactor 2A), MEF2, myocyte enhancer factor 2A, myocyte-specific enhancer factor 2A, RSRFC4, RSRFC9, Serum response factor-like protein 1
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 4205
Common Name: MEF2A Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: ADCAD1, MADS box transcription enhancer factor 2, polypeptide A (myocyte enhancerfactor 2A), MEF2, myocyte enhancer factor 2A, myocyte-specific enhancer factor 2A, RSRFC4, RSRFC9, Serum response factor-like protein 1
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: MEF2A
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51512. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
4205
Common Name:
MEF2A Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
ADCAD1, MADS box transcription enhancer factor 2, polypeptide A (myocyte enhancerfactor 2A), MEF2, myocyte enhancer factor 2A, myocyte-specific enhancer factor 2A, RSRFC4, RSRFC9, Serum response factor-like protein 1
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
MEF2A
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51512. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml