NBP258599PE
Novus Biologicals™ PLA1A Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258599PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP258599PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
51365
Common Name
PLA1A Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
EC 3.1.1, EC 3.1.1.-, NMD, phosphatidylserine-specific phospholipase A1alpha, phospholipase A1 member A, PS-PLA1, PSPLA1Phosphatidylserine-specific phospholipase A1
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
PLA1A
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52379. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PLA1A
- Source: E.coli Amino Acid Sequence: QCQINQVKFKFQSSNRVWKKDRTTIIGKFCTALLPVNDREKMVCLPEPVNLQASVTVSCDLKIAC The PLA1A Recombinant Protein Antigen is derived from E
- coli
- The PLA1A Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 51365
Common Name: PLA1A Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: EC 3.1.1, EC 3.1.1.-, NMD, phosphatidylserine-specific phospholipase A1alpha, phospholipase A1 member A, PS-PLA1, PSPLA1Phosphatidylserine-specific phospholipase A1
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PLA1A
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52379. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
51365
Common Name:
PLA1A Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
EC 3.1.1, EC 3.1.1.-, NMD, phosphatidylserine-specific phospholipase A1alpha, phospholipase A1 member A, PS-PLA1, PSPLA1Phosphatidylserine-specific phospholipase A1
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PLA1A
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52379. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 3164
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Early response protein NAK1, GFRP1ST-59, growth factor-inducible nuclear protein N10, HMRNP10, hormone receptor, MGC9485, N10, NAK1, NAK-1, NGFIB, Nuclear hormone receptor NUR/77, nuclear receptor subfamily 4 group A member 1, nuclear receptor subfamily 4, group A, member 1, NUR77, Orphan nuclear receptor HMR, Orphan nuclear receptor TR3, steroid receptor TR3, Testicular receptor 3, TR3, TR3 orphan receptor
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
3164
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Early response protein NAK1, GFRP1ST-59, growth factor-inducible nuclear protein N10, HMRNP10, hormone receptor, MGC9485, N10, NAK1, NAK-1, NGFIB, Nuclear hormone receptor NUR/77, nuclear receptor subfamily 4 group A member 1, nuclear receptor subfamily 4, group A, member 1, NUR77, Orphan nuclear receptor HMR, Orphan nuclear receptor TR3, steroid receptor TR3, Testicular receptor 3, TR3, TR3 orphan receptor
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 23132
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Androgen receptor-interacting protein 4, ARIP4, EC 3.6.1, EC 3.6.4.12, FLJ21396, FLJ22400, helicase ARIP4, KIAA0809HSPC325, RAD54-like 2 (S. cerevisiae), RAD54-like protein 2, SRISNF2L
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
23132
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Androgen receptor-interacting protein 4, ARIP4, EC 3.6.1, EC 3.6.4.12, FLJ21396, FLJ22400, helicase ARIP4, KIAA0809HSPC325, RAD54-like 2 (S. cerevisiae), RAD54-like protein 2, SRISNF2L
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 23132
Common Name: RAD54L2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: Androgen receptor-interacting protein 4, ARIP4, EC 3.6.1, EC 3.6.4.12, FLJ21396, FLJ22400, helicase ARIP4, KIAA0809HSPC325, RAD54-like 2 (S. cerevisiae), RAD54-like protein 2, SRISNF2L
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: RAD54L2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51350. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
23132
Common Name:
RAD54L2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
Androgen receptor-interacting protein 4, ARIP4, EC 3.6.1, EC 3.6.4.12, FLJ21396, FLJ22400, helicase ARIP4, KIAA0809HSPC325, RAD54-like 2 (S. cerevisiae), RAD54-like protein 2, SRISNF2L
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
RAD54L2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51350. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml