Eg5 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258929-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP258929 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
Eg5
Classification
Polyclonal
Dilution
Western Blot 1:100 - 1:250, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
Eg5, HKSP, kinesin family member 11, kinesin-like 1, Kinesin-like protein 1, kinesin-like protein KIF11, Kinesin-like spindle protein HKSP, Kinesin-related motor protein Eg5, KNSL1TRIP-5, thyroid receptor interacting protein 5, Thyroid receptor-interacting protein 5, TR-interacting protein 5, TRIP5EG5
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
KIF11
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ALIKEYTEEIERLKRDLAAAREKNGVYISEENFRVMSGKLTVQEEQIVELIEKIGAVEEELNRVTELFMDNKNELDQCKSDLQNKTQELETTQKHLQETKLQLVK
Quantity
100 μL
Research Discipline
Cell Cycle and Replication, Chromatin Research, Core ESC Like Genes, Cytoskeleton Markers, Signal Transduction, Stem Cell Markers
Gene ID (Entrez)
3832
Target Species
Human
Isotype
IgG
Related Products
Description
- Eg5 Polyclonal specifically detects Eg5 in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: Eg5
Classification: Polyclonal
Dilution: Western Blot 1:100 - 1:250, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: Eg5, HKSP, kinesin family member 11, kinesin-like 1, Kinesin-like protein 1, kinesin-like protein KIF11, Kinesin-like spindle protein HKSP, Kinesin-related motor protein Eg5, KNSL1TRIP-5, thyroid receptor interacting protein 5, Thyroid receptor-interacting protein 5, TR-interacting protein 5, TRIP5EG5
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: KIF11
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ALIKEYTEEIERLKRDLAAAREKNGVYISEENFRVMSGKLTVQEEQIVELIEKIGAVEEELNRVTELFMDNKNELDQCKSDLQNKTQELETTQKHLQETKLQLVK
Quantity: 100 μL
Research Discipline: Cell Cycle and Replication, Chromatin Research, Core ESC Like Genes, Cytoskeleton Markers, Signal Transduction, Stem Cell Markers
Gene ID (Entrez): 3832
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: E3 ubiquitin-protein ligase MARCH6, EC 6.3.2.-, MARCH-VIDOA10, membrane-associated ring finger (C3HC4) 6, Membrane-associated RING finger protein 6, Membrane-associated RING-CH protein VI, Protein TEB-4, RNF176KIAA0597Doa10 homolog, TEB4RING finger protei
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 10299
Target Species: __
Isotype: __
Antigen: __
Classification: __
Dilution: __
Gene Alias: CGI-37,60S ribosome subunit biogenesis protein NIP7 homolog, HSPC031, KD93FLJ10296, nuclear import 7 homolog (S. cerevisiae)
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 51388
Target Species: __
Isotype: __
