NP197688A94
Lamin A + C Antibody (133A2), Alexa Fluor™ 594, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NP197688A94-Each-of-1 | In Stock | ₹ 58,351.92 |
NP197688A94 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 58,351.92
GST (18%): ₹ 10,503.346
Total Price: ₹ 68,855.266
Antigen
Lamin A + C
Classification
Monoclonal
Conjugate
Alexa Fluor 594
Formulation
50 mM sodium borate with 0.05% sodium azide
Gene Symbols
LMNA
Immunogen
133A2 is a mouse monoclonal IgG3/kappa antibody obtained from fusion of P3/X63.Ag8.653 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with partially purified recombinant human lamin A.
Quantity
0.1 mL
Gene ID (Entrez)
4000.0
Target Species
Human, Mouse, Rat, Bovine, Canine
Isotype
IgG3
Applications
Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Clone
133A2
Dilution
Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen
Gene Alias
CDCD1, CDDC, CMD1A, CMT2B1, dilated 1A (autosomal dominant), EMD2, FPLD, HGPSFPL, lamin A/C, lamin A/C-like 1, lamin-A/C, LDP1, LFP, LGMD1B, limb girdle muscular dystrophy 1B (autosomal dominant), LMN1IDC, LMNC, LMNL1, prelamin-A/C, PRO1,70 kDa lamin, progeria 1 (Hutchinson-Gilford type), renal carcinoma antigen NY-REN-32
Host Species
Mouse
Purification Method
Ion exchange chromatography
Primary or Secondary
Primary
Test Specificity
133A2 recognizes an epitope located between residues 598-611 of lamin A and therefore 133A2 reacts exclusively with lamin A.
Content And Storage
Store at 4°C in the dark.
Related Products
Description
- Lamin A + C Monoclonal specifically detects Lamin A + C in Human, Mouse, Rat, Bovine, Canine samples
- It is validated for Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.
Compare Similar Items
Show Difference
Antigen: Lamin A + C
Classification: Monoclonal
Conjugate: Alexa Fluor 594
Formulation: 50 mM sodium borate with 0.05% sodium azide
Gene Symbols: LMNA
Immunogen: 133A2 is a mouse monoclonal IgG3/kappa antibody obtained from fusion of P3/X63.Ag8.653 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with partially purified recombinant human lamin A.
Quantity: 0.1 mL
Gene ID (Entrez): 4000.0
Target Species: Human, Mouse, Rat, Bovine, Canine
Isotype: IgG3
Applications: Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Clone: 133A2
Dilution: Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen
Gene Alias: CDCD1, CDDC, CMD1A, CMT2B1, dilated 1A (autosomal dominant), EMD2, FPLD, HGPSFPL, lamin A/C, lamin A/C-like 1, lamin-A/C, LDP1, LFP, LGMD1B, limb girdle muscular dystrophy 1B (autosomal dominant), LMN1IDC, LMNC, LMNL1, prelamin-A/C, PRO1,70 kDa lamin, progeria 1 (Hutchinson-Gilford type), renal carcinoma antigen NY-REN-32
Host Species: Mouse
Purification Method: Ion exchange chromatography
Primary or Secondary: Primary
Test Specificity: 133A2 recognizes an epitope located between residues 598-611 of lamin A and therefore 133A2 reacts exclusively with lamin A.
Content And Storage: Store at 4°C in the dark.
Antigen:
Lamin A + C
Classification:
Monoclonal
Conjugate:
Alexa Fluor 594
Formulation:
50 mM sodium borate with 0.05% sodium azide
Gene Symbols:
LMNA
Immunogen:
133A2 is a mouse monoclonal IgG3/kappa antibody obtained from fusion of P3/X63.Ag8.653 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with partially purified recombinant human lamin A.
Quantity:
0.1 mL
Gene ID (Entrez):
4000.0
Target Species:
Human, Mouse, Rat, Bovine, Canine
Isotype:
IgG3
Applications:
Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Clone:
133A2
Dilution:
Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen
Gene Alias:
CDCD1, CDDC, CMD1A, CMT2B1, dilated 1A (autosomal dominant), EMD2, FPLD, HGPSFPL, lamin A/C, lamin A/C-like 1, lamin-A/C, LDP1, LFP, LGMD1B, limb girdle muscular dystrophy 1B (autosomal dominant), LMN1IDC, LMNC, LMNL1, prelamin-A/C, PRO1,70 kDa lamin, progeria 1 (Hutchinson-Gilford type), renal carcinoma antigen NY-REN-32
Host Species:
Mouse
Purification Method:
Ion exchange chromatography
Primary or Secondary:
Primary
Test Specificity:
133A2 recognizes an epitope located between residues 598-611 of lamin A and therefore 133A2 reacts exclusively with lamin A.
Content And Storage:
Store at 4°C in the dark.
Antigen: Integrin alpha 3/CD49c
Classification: Monoclonal
Conjugate: Alexa Fluor 532
Formulation: 50 mM sodium borate with 0.05% sodium azide
Gene Symbols: ITGA3
Immunogen: 158A3 is a mouse monoclonal IgG2a antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additio
Quantity: 0.1 mL
Gene ID (Entrez): 3675.0
Target Species: Human, Canine
Isotype: IgG2a
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Frozen)
Clone: 158A3
Dilution: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen
Gene Alias: antigen identified by monoclonal J143, CD49 antigen-like family member C, CD49c, CD49c antigen, FLJ34631, FLJ34704, FRP-2, Galactoprotein B3, GAP-B3, GAPB3CD49C, integrin alpha-3, integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor), MSK18, VCA-2, very late activation protein 3 receptor, alpha-3 subunit, VL3A, VLA-3 subunit alpha, VLA3a
Host Species: Mouse
Purification Method: Protein A or G purified
Primary or Secondary: Primary
Test Specificity: Reacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit alpha3A. The monoclonal antibody reacts with Human tissues. A broader species reactivity is expected because of the conserved nature of the epitope.
Content And Storage: Store at 4°C in the dark.
Antigen:
Integrin alpha 3/CD49c
Classification:
Monoclonal
Conjugate:
Alexa Fluor 532
Formulation:
50 mM sodium borate with 0.05% sodium azide
Gene Symbols:
ITGA3
Immunogen:
158A3 is a mouse monoclonal IgG2a antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additio
Quantity:
0.1 mL
Gene ID (Entrez):
3675.0
Target Species:
Human, Canine
Isotype:
IgG2a
Applications:
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Frozen)
Clone:
158A3
Dilution:
Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen
Gene Alias:
antigen identified by monoclonal J143, CD49 antigen-like family member C, CD49c, CD49c antigen, FLJ34631, FLJ34704, FRP-2, Galactoprotein B3, GAP-B3, GAPB3CD49C, integrin alpha-3, integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor), MSK18, VCA-2, very late activation protein 3 receptor, alpha-3 subunit, VL3A, VLA-3 subunit alpha, VLA3a
Host Species:
Mouse
Purification Method:
Protein A or G purified
Primary or Secondary:
Primary
Test Specificity:
Reacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit alpha3A. The monoclonal antibody reacts with Human tissues. A broader species reactivity is expected because of the conserved nature of the epitope.
Content And Storage:
Store at 4°C in the dark.
Antigen: Integrin alpha 3/CD49c
Classification: Monoclonal
Conjugate: Alexa Fluor 594
Formulation: 50 mM sodium borate with 0.05% sodium azide
Gene Symbols: ITGA3
Immunogen: 158A3 is a mouse monoclonal IgG2a antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additio
Quantity: 0.1 mL
Gene ID (Entrez): 3675.0
Target Species: Human, Canine
Isotype: IgG2a
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Frozen)
Clone: 158A3
Dilution: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen
Gene Alias: antigen identified by monoclonal J143, CD49 antigen-like family member C, CD49c, CD49c antigen, FLJ34631, FLJ34704, FRP-2, Galactoprotein B3, GAP-B3, GAPB3CD49C, integrin alpha-3, integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor), MSK18, VCA-2, very late activation protein 3 receptor, alpha-3 subunit, VL3A, VLA-3 subunit alpha, VLA3a
Host Species: Mouse
Purification Method: Protein A or G purified
Primary or Secondary: Primary
Test Specificity: Reacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit alpha3A. The monoclonal antibody reacts with Human tissues. A broader species reactivity is expected because of the conserved nature of the epitope.
Content And Storage: Store at 4°C in the dark.
Antigen:
Integrin alpha 3/CD49c
Classification:
Monoclonal
Conjugate:
Alexa Fluor 594
Formulation:
50 mM sodium borate with 0.05% sodium azide
Gene Symbols:
ITGA3
Immunogen:
158A3 is a mouse monoclonal IgG2a antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additio
Quantity:
0.1 mL
Gene ID (Entrez):
3675.0
Target Species:
Human, Canine
Isotype:
IgG2a
Applications:
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Frozen)
Clone:
158A3
Dilution:
Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen
Gene Alias:
antigen identified by monoclonal J143, CD49 antigen-like family member C, CD49c, CD49c antigen, FLJ34631, FLJ34704, FRP-2, Galactoprotein B3, GAP-B3, GAPB3CD49C, integrin alpha-3, integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor), MSK18, VCA-2, very late activation protein 3 receptor, alpha-3 subunit, VL3A, VLA-3 subunit alpha, VLA3a
Host Species:
Mouse
Purification Method:
Protein A or G purified
Primary or Secondary:
Primary
Test Specificity:
Reacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit alpha3A. The monoclonal antibody reacts with Human tissues. A broader species reactivity is expected because of the conserved nature of the epitope.
Content And Storage:
Store at 4°C in the dark.
Antigen: Integrin alpha 3/CD49c
Classification: Monoclonal
Conjugate: Alexa Fluor 532
Formulation: 50 mM sodium borate with 0.05% sodium azide
Gene Symbols: ITGA3
Immunogen: Clone 29A3 is a mouse monoclonal IgG1, kappa antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
Quantity: 0.1 mL
Gene ID (Entrez): 3675.0
Target Species: Human, Porcine
Isotype: IgG1
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Frozen)
Clone: 29A3
Dilution: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen
Gene Alias: antigen identified by monoclonal J143, CD49 antigen-like family member C, CD49c, CD49c antigen, FLJ34631, FLJ34704, FRP-2, Galactoprotein B3, GAP-B3, GAPB3CD49C, integrin alpha-3, integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor), MSK18, VCA-2, very late activation protein 3 receptor, alpha-3 subunit, VL3A, VLA-3 subunit alpha, VLA3a
Host Species: Mouse
Purification Method: Protein A or G purified
Primary or Secondary: Primary
Test Specificity: 29A3 recognizes specifically the cytoplasmic domain of integrin subunit alpha3A. The monoclonal antibody reacts with Human tissues. A broader species reactivity is expected because of the conserved nature of the epitope.
Content And Storage: Store at 4°C in the dark.
Antigen:
Integrin alpha 3/CD49c
Classification:
Monoclonal
Conjugate:
Alexa Fluor 532
Formulation:
50 mM sodium borate with 0.05% sodium azide
Gene Symbols:
ITGA3
Immunogen:
Clone 29A3 is a mouse monoclonal IgG1, kappa antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
Quantity:
0.1 mL
Gene ID (Entrez):
3675.0
Target Species:
Human, Porcine
Isotype:
IgG1
Applications:
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Frozen)
Clone:
29A3
Dilution:
Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen
Gene Alias:
antigen identified by monoclonal J143, CD49 antigen-like family member C, CD49c, CD49c antigen, FLJ34631, FLJ34704, FRP-2, Galactoprotein B3, GAP-B3, GAPB3CD49C, integrin alpha-3, integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor), MSK18, VCA-2, very late activation protein 3 receptor, alpha-3 subunit, VL3A, VLA-3 subunit alpha, VLA3a
Host Species:
Mouse
Purification Method:
Protein A or G purified
Primary or Secondary:
Primary
Test Specificity:
29A3 recognizes specifically the cytoplasmic domain of integrin subunit alpha3A. The monoclonal antibody reacts with Human tissues. A broader species reactivity is expected because of the conserved nature of the epitope.
Content And Storage:
Store at 4°C in the dark.