Classification:
Polyclonal
Gene Alias:
9130025P16Rik; 9630036G24; AA617266; AA789574; ACHM7; activating transcription factor 6; activating transcription factor 6 alpha; Activating transcription factor 6 beta; ATF 6; Atf6; ATF6 alpha; ATF6A; Atf6alpha; ATF6-alpha; Atf6b; ATF6beta; ATF6-beta; cAMP response element binding protein-related protein; cAMP response element-binding protein-related protein; cAMP responsive element binding protein-like 1; cAMP-dependent transcription factor ATF-6 alpha; cAMP-dependent transcription factor ATF-6 beta; cAMP-responsive element-binding protein-like 1; Crebl1; Creb-related protein; CREB-RP; Cyclic AMP-dependent transcription factor ATF-6 alpha; cyclic AMP-dependent transcription factor ATF-6 beta; DKFZp686P2194; ESTM49; FLJ21663; G13; Processed cyclic AMP-dependent transcription factor ATF-6 alpha; Processed cyclic AMP-dependent transcription factor ATF-6 beta; Protein G13
Purification Method:
Affinity chromatography
Gene ID (Entrez):
12915, 1388, 226641, 22926, 304962, 406169
Content And Storage:
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Applications:
Immunohistochemistry (Paraffin), Western Blot
Formulation:
PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.:
F6VAN0, G3V909, O35451, P18850, Q99941
Gene Symbols:
ATF6, ATF6B
Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human ATF6 (597-629aa AININENVINGQDYEVMMQIDCQVMDTRILHIK).
Primary or Secondary:
Primary
Target Species:
Human, Mouse, Rat