CD16 Polyclonal Antibody, Invitrogen™
Manufacturer: Thermo Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | PIPA579244-Each-of-1 | In Stock | ₹ 39,870.96 |
PIPA579244 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 39,870.96
GST (18%): ₹ 7,176.773
Total Price: ₹ 47,047.733
Antigen
CD16
Classification
Polyclonal
Conjugate
Unconjugated
Gene
FCGR3A
Gene Alias
4833442P21Rik; CD16; CD16-2; CD16A; CD16a antigen; CD16b; CD32; CD32 receptor 2; CDw32; cytolytic trigger molecule G7; Fc fragment of IgG intermediate affinity IV receptor; Fc fragment of IgG low affinity IIIa receptor; Fc fragment of IgG receptor IIIa; Fc fragment of IgG receptor IIIb; Fc fragment of IgG, low affinity III, receptor for (CD16); Fc fragment of IgG, low affinity IIIa, receptor; Fc fragment of IgG, low affinity IIIa, receptor (CD16a); Fc fragment of IgG, low affinity IIIa, receptor for (CD16); Fc fragment of IgG, low affinity IIIa, receptor for (CD16); Fc fragment of IgG, low affinity III, receptor for (CD16); Fc fragment of IgG, low affinity IIIb, receptor (CD16b); Fc gamma receptor III; Fc gamma receptor IIIa; Fc gamma receptor III-A; Fc gamma receptor IIIb; Fc gamma RIIIa; Fc gammaRIV; Fc receptor, IgG, low affinity III; Fc receptor, IgG, low affinity IV; Fc receptor-like 3; Fcg receptor III; FCG2; FCG3; Fc-gamma receptor III-2 (CD 16); Fc-gamma receptor IIIb (CD 16); Fc-gamma receptor IIIb (CD16); Fc-gamma RII-b; Fc-gamma RII-c; fc-gamma RIII; Fc-gamma RIIIa; Fc-gamma RIII-alpha; fc-gamma RIIIb; fc-gamma RIII-beta; Fc-gamma-RIIb; Fc-gamma-RIIc; FcgammaRIII; FcgammaRIII a.1; FcgammaRIII a.2; FcgammaRIII a.3; FcgammaRIIIA; FcgammaRIV; FCGR2; FCGR2A; FCGR2B; FCGR2C; FCGR3; Fcgr3a; FCGR3B; Fcgr4; FCGRIII; FcgRIV; FcR-10; FcRII-b; FcRII-c; FcRIII; FCRIIIA; FCRIIIb; Fcrl3; IGFR3; IgG Fc gamma receptor III; igG Fc receptor III; IgG Fc receptor III-1; igG Fc receptor III-2; IMD20; immunoglobulin G Fc receptor III; LOC100911825; Low affinity immunoglobulin gamma Fc region receptor III; low affinity immunoglobulin gamma Fc region receptor III-A; Low affinity immunoglobulin gamma Fc region receptor III-B; low affinity immunoglobulin gamma Fc region receptor III-like; Low affinity immunoglobulin gamma Fc region receptor IV; neutrophil-specific antigen NA; RP11-5K23.1; transmembrane receptor FcgammaRIII-X
Host Species
Rabbit
Purification Method
Antigen affinity chromatography
Regulatory Status
RUO
Gene ID (Entrez)
2214, 2215
Content And Storage
-20°C
Form
Lyophilized
Applications
Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Concentration
500 μg/mL
Formulation
PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.
O75015, P08637
Gene Symbols
FCGR3A, FCGR3B
Immunogen
E. coli-derived human CD16 recombinant protein (Position: Q101-D166).
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human
Product Type
Antibody
Isotype
IgG
Related Products
Description
- Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL
- CD16 encodes a receptor that recognizes the Fc portion of immunoglobulin G and is involved in the clearance of immune complexes from the circulation, as well as other functions such as cellular mediated cytotoxicity and enhancement of virus infections
- This gene, FCGR3A, shares a high degree of similarity with another nearby gene, FCGR3B, located on chromosome 1
- The receptor encoded by this gene is expressed on natural killer (NK) cells as an integral membrane glycoprotein anchored through a transmembrane peptide, while FCGR3B is expressed on polymorphonuclear neutrophils (PMN) where the receptor is anchored through a phosphatidylinositol (PI) linkage
- Mutations in this gene have been associated with immunodeficiency 20 and have been linked to susceptibility to recurrent viral infections, susceptibility to systemic lupus erythematosus, and alloimmune neonatal neutropenia
- Alternatively spliced transcript variants encoding different isoforms have been found for this gene
- Diseases associated with FCGR3A include Immunodeficiency 20 and Herpes Zoster.
Compare Similar Items
Show Difference
Antigen: CD16
Classification: Polyclonal
Conjugate: Unconjugated
Gene: FCGR3A
Gene Alias: 4833442P21Rik; CD16; CD16-2; CD16A; CD16a antigen; CD16b; CD32; CD32 receptor 2; CDw32; cytolytic trigger molecule G7; Fc fragment of IgG intermediate affinity IV receptor; Fc fragment of IgG low affinity IIIa receptor; Fc fragment of IgG receptor IIIa; Fc fragment of IgG receptor IIIb; Fc fragment of IgG, low affinity III, receptor for (CD16); Fc fragment of IgG, low affinity IIIa, receptor; Fc fragment of IgG, low affinity IIIa, receptor (CD16a); Fc fragment of IgG, low affinity IIIa, receptor for (CD16); Fc fragment of IgG, low affinity IIIa, receptor for (CD16); Fc fragment of IgG, low affinity III, receptor for (CD16); Fc fragment of IgG, low affinity IIIb, receptor (CD16b); Fc gamma receptor III; Fc gamma receptor IIIa; Fc gamma receptor III-A; Fc gamma receptor IIIb; Fc gamma RIIIa; Fc gammaRIV; Fc receptor, IgG, low affinity III; Fc receptor, IgG, low affinity IV; Fc receptor-like 3; Fcg receptor III; FCG2; FCG3; Fc-gamma receptor III-2 (CD 16); Fc-gamma receptor IIIb (CD 16); Fc-gamma receptor IIIb (CD16); Fc-gamma RII-b; Fc-gamma RII-c; fc-gamma RIII; Fc-gamma RIIIa; Fc-gamma RIII-alpha; fc-gamma RIIIb; fc-gamma RIII-beta; Fc-gamma-RIIb; Fc-gamma-RIIc; FcgammaRIII; FcgammaRIII a.1; FcgammaRIII a.2; FcgammaRIII a.3; FcgammaRIIIA; FcgammaRIV; FCGR2; FCGR2A; FCGR2B; FCGR2C; FCGR3; Fcgr3a; FCGR3B; Fcgr4; FCGRIII; FcgRIV; FcR-10; FcRII-b; FcRII-c; FcRIII; FCRIIIA; FCRIIIb; Fcrl3; IGFR3; IgG Fc gamma receptor III; igG Fc receptor III; IgG Fc receptor III-1; igG Fc receptor III-2; IMD20; immunoglobulin G Fc receptor III; LOC100911825; Low affinity immunoglobulin gamma Fc region receptor III; low affinity immunoglobulin gamma Fc region receptor III-A; Low affinity immunoglobulin gamma Fc region receptor III-B; low affinity immunoglobulin gamma Fc region receptor III-like; Low affinity immunoglobulin gamma Fc region receptor IV; neutrophil-specific antigen NA; RP11-5K23.1; transmembrane receptor FcgammaRIII-X
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 2214, 2215
Content And Storage: -20°C
Form: Lyophilized
Applications: Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.: O75015, P08637
Gene Symbols: FCGR3A, FCGR3B
Immunogen: E. coli-derived human CD16 recombinant protein (Position: Q101-D166).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Product Type: Antibody
Isotype: IgG
Antigen: FCGRT
Classification: Polyclonal
Conjugate: Unconjugated
Gene: FCGRT
Gene Alias: alpha-chain; Fc fragment of IgG receptor and transporter; Fc fragment of IgG, receptor, transporter, alpha; Fc receptor, IgG, alpha chain transporter; FCGRT; FCRN; FcRn alpha chain; heavy chain of the major histocompatibility complex class I-like Fc receptor; IgG Fc fragment receptor transporter alpha chain; IgG receptor FcRn large subunit p51; immunoglobulin receptor, intestinal, heavy chain; major histocompatibility complex class I-like Fc receptor; neonatal Fc receptor; neonatal Fc-receptor for Ig; transmembrane alpha chain of the neonatal receptor
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 14132
Content And Storage: -20°C
Form: Lyophilized
Applications: ELISA, Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: Q61559
Gene Symbols: FCGRT
Immunogen: E. coli-derived mouse FCGRT recombinant protein (Position: Q54-D291).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Mouse
Product Type: Antibody
Isotype: IgG
Antigen: FDCSP
Classification: Polyclonal
Conjugate: Unconjugated
Gene: FDCSP
Gene Alias: C4orf7; FDC secreted protein; FDCSP; FDC-SP; follicular dendritic cell secreted; follicular dendritic cell secreted peptide; follicular dendritic cell secreted protein; LOC494224; UNQ733/PRO1419
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 260436
Content And Storage: -20°C
Form: Lyophilized
Applications: Immunohistochemistry (Paraffin)
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.: Q8NFU4
Gene Symbols: FDCSP
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human FDCSP (18-51aa FPVSQDQEREKRSISDSDELASGFFVFPYPYPFR).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Product Type: Antibody
Isotype: IgG
