Classification:
Polyclonal
Gene Alias:
AT24755; BcDNA:GM08679; cg 6203 gene product from transcript cg6203-rc; cg6203; CG6203-PA; CG6203-PB; CG6203-PC; CG6203-PD; CG6203-PE; CG6203-PF; CG6203-PG; CG6203-PH; CG6203-PI; CG6203-PJ; CG6203-PK; dFMR; DFmr1; dFmrp; dfxr; dfxr1; dFXRP; Dmel\CG6203; Dmel_CG6203; dmfr1; drosophila fragile X mental retardation protein; EP(3)3517; FMR; FMR1; Fmr-1; Fmr1-PA; Fmr1-PB; Fmr1-PC; Fmr1-PD; Fmr1-PE; Fmr1-PF; Fmr1-PG; Fmr1-PH; Fmr1-PI; Fmr1-PJ; Fmr1-PK; FMRP; FMRP translational regulator 1; fragile X; fragile X mental retardation; fragile X mental retardation 1; fragile X mental retardation gene; fragile X mental retardation protein; fragile X mental retardation protein 1; Fragile X mental retardation protein 1 homolog; fragile X mental retardation related 1; fragile X mental retardation syndrome 1; fragile X mental retardation syndrome 1 homolog; Fragile X mental retardation syndrome-related protein 1; fragile X mental retardation-1 protein; fragile X protein; fragile x related; fragile X re
Purification Method:
Antigen affinity chromatography
Gene ID (Entrez):
14265, 2332, 24948
Content And Storage:
-20°C
Applications:
Immunocytochemistry, Immunohistochemistry (Paraffin), Western Blot
Formulation:
PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.:
P35922, Q06787, Q80WE1
Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human FMRP (164-200aa ENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIM).
Primary or Secondary:
Primary
Target Species:
Human, Mouse, Rat