FMRP Polyclonal Antibody, Invitrogen™
Manufacturer: Thermo Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | PIPA579278-Each-of-1 | In Stock | ₹ 38,844.24 |
PIPA579278 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 38,844.24
GST (18%): ₹ 6,991.963
Total Price: ₹ 45,836.203
Antigen
FMRP
Classification
Polyclonal
Conjugate
Unconjugated
Gene
FMR1
Gene Alias
AT24755; BcDNA:GM08679; cg 6203 gene product from transcript cg6203-rc; cg6203; CG6203-PA; CG6203-PB; CG6203-PC; CG6203-PD; CG6203-PE; CG6203-PF; CG6203-PG; CG6203-PH; CG6203-PI; CG6203-PJ; CG6203-PK; dFMR; DFmr1; dFmrp; dfxr; dfxr1; dFXRP; Dmel\CG6203; Dmel_CG6203; dmfr1; drosophila fragile X mental retardation protein; EP(3)3517; FMR; FMR1; Fmr-1; Fmr1-PA; Fmr1-PB; Fmr1-PC; Fmr1-PD; Fmr1-PE; Fmr1-PF; Fmr1-PG; Fmr1-PH; Fmr1-PI; Fmr1-PJ; Fmr1-PK; FMRP; FMRP translational regulator 1; fragile X; fragile X mental retardation; fragile X mental retardation 1; fragile X mental retardation gene; fragile X mental retardation protein; fragile X mental retardation protein 1; Fragile X mental retardation protein 1 homolog; fragile X mental retardation related 1; fragile X mental retardation syndrome 1; fragile X mental retardation syndrome 1 homolog; Fragile X mental retardation syndrome-related protein 1; fragile X mental retardation-1 protein; fragile X protein; fragile x related; fragile X re
Host Species
Rabbit
Purification Method
Antigen affinity chromatography
Regulatory Status
RUO
Gene ID (Entrez)
14265, 2332, 24948
Content And Storage
-20°C
Form
Lyophilized
Applications
Immunocytochemistry, Immunohistochemistry (Paraffin), Western Blot
Concentration
500 μg/mL
Formulation
PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.
P35922, Q06787, Q80WE1
Gene Symbols
FMR1
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human FMRP (164-200aa ENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIM).
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human, Mouse, Rat
Product Type
Antibody
Isotype
IgG
Related Products
Description
- Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL
- FMR1 binds RNA and is associated with polysomes
- The protein may be involved in mRNA trafficking from the nucleus to the cytoplasm
- A trinucleotide repeat in the 5' UTR is normally found at 6-53 copies, but an expansion to 55-230 repeats is the cause of fragile X syndrome
- Expansion of the trinucleotide repeat may also cause one form of premature ovarian failure
- Multiple alternatively spliced transcript variants that encode different protein isoforms and which are located in different cellular locations have been described for this gene.
Compare Similar Items
Show Difference
Antigen: FMRP
Classification: Polyclonal
Conjugate: Unconjugated
Gene: FMR1
Gene Alias: AT24755; BcDNA:GM08679; cg 6203 gene product from transcript cg6203-rc; cg6203; CG6203-PA; CG6203-PB; CG6203-PC; CG6203-PD; CG6203-PE; CG6203-PF; CG6203-PG; CG6203-PH; CG6203-PI; CG6203-PJ; CG6203-PK; dFMR; DFmr1; dFmrp; dfxr; dfxr1; dFXRP; Dmel\CG6203; Dmel_CG6203; dmfr1; drosophila fragile X mental retardation protein; EP(3)3517; FMR; FMR1; Fmr-1; Fmr1-PA; Fmr1-PB; Fmr1-PC; Fmr1-PD; Fmr1-PE; Fmr1-PF; Fmr1-PG; Fmr1-PH; Fmr1-PI; Fmr1-PJ; Fmr1-PK; FMRP; FMRP translational regulator 1; fragile X; fragile X mental retardation; fragile X mental retardation 1; fragile X mental retardation gene; fragile X mental retardation protein; fragile X mental retardation protein 1; Fragile X mental retardation protein 1 homolog; fragile X mental retardation related 1; fragile X mental retardation syndrome 1; fragile X mental retardation syndrome 1 homolog; Fragile X mental retardation syndrome-related protein 1; fragile X mental retardation-1 protein; fragile X protein; fragile x related; fragile X re
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 14265, 2332, 24948
Content And Storage: -20°C
Form: Lyophilized
Applications: Immunocytochemistry, Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: P35922, Q06787, Q80WE1
Gene Symbols: FMR1
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human FMRP (164-200aa ENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIM).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen: FNDC5
Classification: Polyclonal
Conjugate: Unconjugated
Gene: FNDC5
Gene Alias: 1500001L03Rik; AI836596; C87088; fibronectin type III domain containing 5; fibronectin type III domain-containing protein 5; Fibronectin type III repeat-containing protein 2; Fndc5; Frcp2; Irisin; PeP; Peroxisomal protein; Pxp
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 252995, 260327, 384061
Content And Storage: -20°C
Form: Lyophilized
Applications: Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.: Q8K3V5, Q8K4Z2, Q8NAU1
Gene Symbols: FNDC5
Immunogen: E. coli-derived human FNDC5 recombinant protein (Position: D32-E143).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen: FosB
Classification: Polyclonal
Conjugate: Unconjugated
Gene: Fosb
Gene Alias: activator protein 1; AP-1; DKFZp686C0818; FBJ murine osteosarcoma viral oncogene homolog B; FBJ murine osteosarcoma viral oncogene-like protein B; FBJ osteosarcoma oncogene B; FBJ osteosarcoma viral oncogene isoform deltaFosb-2; fos b; FOSB; FosB proto-oncogene, AP-1 trancription factor subunit; FosB proto-oncogene, AP-1 transcription factor subunit; fra-2; G0/G1 switch regulatory protein 3; G0S3; GOS3; GOSB; LOW QUALITY PROTEIN: protein fosB; MGC42291; oncogene FOS-B; protein fosB; zgc:92354
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 100360880, 14282, 2354
Content And Storage: -20°C
Form: Lyophilized
Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: D3ZLB7, P13346, P53539
Gene Symbols: Fosb
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Fos B (264-291aa LPFQTSQDAPPNLTASLFTHSEVQVLGD).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
