HSPE1 Polyclonal Antibody, Invitrogen™
Manufacturer: Thermo Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | PIPA579415-Each-of-1 | In Stock | ₹ 38,844.24 |
PIPA579415 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 38,844.24
GST (18%): ₹ 6,991.963
Total Price: ₹ 45,836.203
Antigen
HSPE1
Classification
Polyclonal
Conjugate
Unconjugated
Gene
HSPE1
Gene Alias
10 kDa chaperonin; 10 kDa heat shock protein, mitochondrial; 10 kDa heat shock protein, mitochondrial; MOB-like protein phocein; 10kDa; 10kDa Chaperonin; CH10; chaperonin 10; Cpn 10; CPN10; cpn10 protein; early pregnancy factor; early-pregnancy factor; EPF; GROES; Heat shock 10 kD protein 1 (chaperonin 10); heat shock 10 kDa protein 1 (chaperonin 10); heat shock 10 protein 1; heat shock 105kDa/110kDa protein 1; heat shock 10kD protein; heat shock 10kD protein 1 (chaperonin 10); heat shock 10kDa protein 1; heat shock 10kDa protein 1 (chaperonin 10); heat shock protein; heat shock protein 1 (chaperonin 10); heat shock protein 105; heat shock protein 105 kDa; heat shock protein 105 kDa; LOW QUALITY PROTEIN: heat shock protein 105 kDa; heat shock protein family E (Hsp10) member 1; heat shock protein family E (Hsp10) member 1 L homeolog; heat shock protein family H (Hsp110) member 1; HSP; hsp10; hsp105; hsp105a; hsp105b; hsp110; Hspe1; hspe1.L; Hsph1; hsph1-a; hsph1-b; mitochondrial 10 kDa
Host Species
Rabbit
Purification Method
Antigen affinity chromatography
Regulatory Status
RUO
Gene ID (Entrez)
15528, 25462, 3336
Content And Storage
-20°C
Form
Lyophilized
Applications
Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Paraffin), Western Blot
Concentration
500 μg/mL
Formulation
PBS with 5MG BSA and 0.05MG sodium azide, 0.05MG thimerosal
Gene Accession No.
P26772, P61604, Q64433
Gene Symbols
HSPE1
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Cpn10 (81-102aa VVLDDKDYFLFRDGDILGKYVD).
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human, Mouse, Rat
Product Type
Antibody
Isotype
IgG
Related Products
Description
- Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL
- The heat shock proteins (HSPs) comprise a group of highly conserved, abundantly expressed proteins with diverse functions, including the assembly and sequestering of multiprotein complexes, transportation of nascent polypeptide chains across cellular membranes and regulation of protein folding
- Heat shock proteins (also known as molecular chaperones) fall into six general families: HSP 90, HSP 70, HSP 60, the low molecular weight HSPs, the immunophilins and the HSP 110 family
- The low molecular weight family includes HSP 10, HSP 20, HSP 27 (Heme Oxygenase 1), HSP 32 and HSP 40
- Chaperonins are ubiquitous, indispensable proteins that facilitate protein folding in an ATP-dependent manner, enhancing the yield of properly folded substrate protein under conditions where spontaneous folding does not occur
- Chaperonins are typified by the E
- coli heat-shock proteins GroEL and GroES (HSP 10)
- HSP 10 is a heptameric ring of identical 10 kDa subunits that binds to each end of GroEL to form a symmetric, functional heterodimer.
Compare Similar Items
Show Difference
Antigen: HSPE1
Classification: Polyclonal
Conjugate: Unconjugated
Gene: HSPE1
Gene Alias: 10 kDa chaperonin; 10 kDa heat shock protein, mitochondrial; 10 kDa heat shock protein, mitochondrial; MOB-like protein phocein; 10kDa; 10kDa Chaperonin; CH10; chaperonin 10; Cpn 10; CPN10; cpn10 protein; early pregnancy factor; early-pregnancy factor; EPF; GROES; Heat shock 10 kD protein 1 (chaperonin 10); heat shock 10 kDa protein 1 (chaperonin 10); heat shock 10 protein 1; heat shock 105kDa/110kDa protein 1; heat shock 10kD protein; heat shock 10kD protein 1 (chaperonin 10); heat shock 10kDa protein 1; heat shock 10kDa protein 1 (chaperonin 10); heat shock protein; heat shock protein 1 (chaperonin 10); heat shock protein 105; heat shock protein 105 kDa; heat shock protein 105 kDa; LOW QUALITY PROTEIN: heat shock protein 105 kDa; heat shock protein family E (Hsp10) member 1; heat shock protein family E (Hsp10) member 1 L homeolog; heat shock protein family H (Hsp110) member 1; HSP; hsp10; hsp105; hsp105a; hsp105b; hsp110; Hspe1; hspe1.L; Hsph1; hsph1-a; hsph1-b; mitochondrial 10 kDa
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 15528, 25462, 3336
Content And Storage: -20°C
Form: Lyophilized
Applications: Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide, 0.05MG thimerosal
Gene Accession No.: P26772, P61604, Q64433
Gene Symbols: HSPE1
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Cpn10 (81-102aa VVLDDKDYFLFRDGDILGKYVD).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen: HTRA1
Classification: Polyclonal
Conjugate: Unconjugated
Gene: HTRA1
Gene Alias: AI429470; ARMD7; CADASIL2; CARASIL; High-temperature requirement A serine peptidase 1; HTRA; HtrA serine peptidase 1; Htra1; IGF binding; IGFBP5-protease; insulin-like growth factor binding protein 5 protease; L56; ORF480; protease serine 11; protease, serine, 11; protease, serine, 11 (IGF binding); PRSS11; RSPP11; serine protease; serine protease 11; Serine protease HTRA1; similar to bacterial htrA and degP
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 56213, 5654, 65164
Content And Storage: -20°C
Form: Lyophilized
Applications: Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.: Q92743, Q9QZK5, Q9R118
Gene Symbols: HTRA1
Immunogen: A synthetic peptide corresponding to a sequence of human HTRA1 (QLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIAD).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen: HYAL1
Classification: Polyclonal
Conjugate: Unconjugated
Gene: HYAL1
Gene Alias: Hya1; HYAL1; Hyal-1; Hyaluronidase; hyaluronidase 1; hyaluronidase-1; hyaluronoglucosaminidase 1; hyaluronoglucosaminidase-1; LUCA1; LuCa-1; Lung carcinoma protein 1; MPS9; NAT6; plasma hyaluronidase; tumor suppressor LUCA-1
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 15586
Content And Storage: -20°C
Form: Lyophilized
Applications: Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide, 0.05MG thimerosal
Gene Accession No.: Q91ZJ9
Gene Symbols: HYAL1
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse HYAL1 (434-450aa LKDRAQMAMKFRCRCYR).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Mouse
Product Type: Antibody
Isotype: IgG
