PIK3R2 Polyclonal Antibody, Invitrogen™
Manufacturer: Thermo Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | PIPA579822-Each-of-1 | In Stock | ₹ 39,015.36 |
PIPA579822 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 39,015.36
GST (18%): ₹ 7,022.765
Total Price: ₹ 46,038.125
Antigen
PIK3R2
Classification
Polyclonal
Conjugate
Unconjugated
Gene
PIK3R2
Gene Alias
MPPH; MPPH1; p85; P85B; p85beta; p85-BETA; phosphatidylinositol 3-kinase; phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta; phosphatidylinositol 3-kinase regulartory subunit polypeptide 2; phosphatidylinositol 3-kinase regulatory subunit beta; phosphatidylinositol 3-kinase, regulartory subunit, polypeptide 2; phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 2 (p85 beta); phosphoinositide-3-kinase regulatory subunit 2; phosphoinositide-3-kinase regulatory subunit beta; phosphoinositide-3-kinase, regulatory subunit 2 (beta); phosphoinositide-3-kinase, regulatory subunit 2 (p85 beta); phosphoinositide-3-kinase, regulatory subunit, polypeptide 2 (p85 beta); PI3K; PI3K regulatory subunit beta; PI3-kinase p85 subunit beta; PI3-kinase regulatory subunit beta; PI3-kinase subunit p85-beta; PIK3R2; ptdIns-3-kinase p85-beta; ptdIns-3-kinase regulatory subunit beta; ptdIns-3-kinase regulatory subunit p85-beta
Host Species
Rabbit
Purification Method
Antigen affinity chromatography
Regulatory Status
RUO
Gene ID (Entrez)
18709, 29741, 5296
Content And Storage
-20°C
Form
Lyophilized
Applications
Immunohistochemistry (Paraffin), Western Blot
Concentration
500 μg/mL
Formulation
PBS with 5MG BSA and 0.05MG sodium azide, 0.05MG thimerosal
Gene Accession No.
O00459, O08908, Q63788
Gene Symbols
PIK3R2
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human PIK3R2 (447-461aa KVYHQQYQDKSREYD).
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human, Mouse, Rat
Product Type
Antibody
Isotype
IgG
Related Products
Description
- Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL
- Binds to activated (phosphorylated) protein-tyrosine kinases, through its SH2 domain, and acts as an adapter, mediating the association of the p110 catalytic unit to the plasma membrane.
Compare Similar Items
Show Difference
Antigen: PIK3R2
Classification: Polyclonal
Conjugate: Unconjugated
Gene: PIK3R2
Gene Alias: MPPH; MPPH1; p85; P85B; p85beta; p85-BETA; phosphatidylinositol 3-kinase; phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta; phosphatidylinositol 3-kinase regulartory subunit polypeptide 2; phosphatidylinositol 3-kinase regulatory subunit beta; phosphatidylinositol 3-kinase, regulartory subunit, polypeptide 2; phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 2 (p85 beta); phosphoinositide-3-kinase regulatory subunit 2; phosphoinositide-3-kinase regulatory subunit beta; phosphoinositide-3-kinase, regulatory subunit 2 (beta); phosphoinositide-3-kinase, regulatory subunit 2 (p85 beta); phosphoinositide-3-kinase, regulatory subunit, polypeptide 2 (p85 beta); PI3K; PI3K regulatory subunit beta; PI3-kinase p85 subunit beta; PI3-kinase regulatory subunit beta; PI3-kinase subunit p85-beta; PIK3R2; ptdIns-3-kinase p85-beta; ptdIns-3-kinase regulatory subunit beta; ptdIns-3-kinase regulatory subunit p85-beta
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 18709, 29741, 5296
Content And Storage: -20°C
Form: Lyophilized
Applications: Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide, 0.05MG thimerosal
Gene Accession No.: O00459, O08908, Q63788
Gene Symbols: PIK3R2
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human PIK3R2 (447-461aa KVYHQQYQDKSREYD).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen: PINX1
Classification: Polyclonal
Conjugate: Unconjugated
Gene: PINX1
Gene Alias: 2210403I16Rik; 2610028A01Rik; 67-11-3; 67-11-3 protein; AU024023; EMBL:ABO28828.1}; FLJ20565; hepatocellular carcinoma-related putative tumor suppressor; liver-related putative tumor suppressor; LPTL; Lpts; LPTS1; MGC8850; PIN2 interacting protein 1; PIN2/TERF1 interacting, telomerase inhibitor 1; PIN2/TERF1-interacting telomerase inhibitor 1; PIN2/TRF1-interacting protein; pin2-interact; PIN2-interacting protein 1; PIN2-interacting protein X1; Pinx1; pinx1 {ECO:0000312; Protein 67-11-3; RGD1566025; TRF1-interacting protein 1
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 54984
Content And Storage: -20°C
Form: Lyophilized
Applications: Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: Q96BK5
Gene Symbols: PINX1
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human PINX1 (54-83aa DHIKVQVKNNHLGLGATINNEDNWIAHQDD).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Product Type: Antibody
Isotype: IgG
Antigen: PKLR
Classification: Polyclonal
Conjugate: Unconjugated
Gene: PKLR
Gene Alias: isozymes R/L; L-PK; PK1; Pk-1; PKL; Pklg; Pklr; PKR; PKRL; Pyruvate kinase 1; pyruvate kinase isozyme R/L; pyruvate kinase isozymes L/R; pyruvate kinase isozymes R/L; pyruvate kinase liver and red blood cell; pyruvate kinase PKLR; pyruvate kinase type L; pyruvate kinase, liver and blood cell; pyruvate kinase, liver and RBC; pyruvate kinase, liver and red blood cell; red cell/liver pyruvate kinase; RPK; R-PK; R-type/L-type pyruvate kinase
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 18770, 24651, 5313
Content And Storage: -20°C
Form: Lyophilized
Applications: Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: P12928, P30613, P53657
Gene Symbols: PKLR
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PKLR (522-552aa EAIWADDVDRRVQFGIESGKLRGFLRVGDLV).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
