MYPT1 Polyclonal Antibody, Invitrogen™
Manufacturer: Thermo Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | PIPA579857-Each-of-1 | In Stock | ₹ 39,357.60 |
PIPA579857 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 39,357.60
GST (18%): ₹ 7,084.368
Total Price: ₹ 46,441.968
Antigen
MYPT1
Classification
Polyclonal
Conjugate
Unconjugated
Gene
PPP1R12A
Gene Alias
1200015F06Rik; 130 kDa myosin-binding subunit of smooth muscle myosin phophatase; 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130); 130 kDa myosin-binding subunit of smooth muscle myosin phosphatase; 130 kDa regulatory subunit of myosin phosphatase; 133kDa myosin-binding subunit of smooth muscle myosin phosphatase (M133); 5730577I22Rik; AA792106; AV099298; D10Ertd625e; hypothetical protein; I79_016312; LOW QUALITY PROTEIN: protein phosphatase 1 regulatory subunit 12A; M110; M130; M130 of smooth muscle myosin phosphatase; MBS; MBSP; myosin binding subunit; myosin phosphatase target subunit 1; myosin phosphatase, target subunit 1; myosin phosphatase-targeting subunit 1; myosin-binding subunit of myosin phosphatase; Mypt1; PP-1M; PP1M M110 subunit; PP1M subunit M110; Ppp1r12a; Protein phosphatase 1 regulatory subunit 12A; protein phosphatase 1, regulatory (inhibitor) subunit 12A; protein phosphatase 1, regulatory subunit 12A; protein phosphatase 1M 110 kda regulatory subunit; protein phosphatase myosin-binding subunit; Protein phosphatase subunit 1M; serine/threonine protein phosphatase PP1 smooth muscle regulatory subunit M110; si:dkey-28j4.1; smooth muscle myosin phosphatase myosin-binding subunit; unm p82emcf; unm_p82emcf; zgc:110448; zgc:110448 protein
Host Species
Rabbit
Purification Method
Antigen affinity chromatography
Regulatory Status
RUO
Gene ID (Entrez)
116670, 17931, 4659
Content And Storage
-20°C
Form
Lyophilized
Applications
Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Paraffin), Western Blot
Concentration
500 μg/mL
Formulation
PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.
O14974, Q10728, Q9DBR7
Gene Symbols
PPP1R12A
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human PPP1R12A (1-40aa MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDD).
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human, Mouse, Non-human Primate, Rat
Product Type
Antibody
Isotype
IgG
Related Products
Description
- Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL
- Myosin phosphatase target subunit 1, which is also called the myosin-binding subunit of myosin phosphatase, is one of the subunits of myosin phosphatase
- Myosin phosphatase regulates the interaction of actin and myosin downstream of the guanosine triphosphatase Rho
- The small guanosine triphosphatase Rho is implicated in myosin light chain (MLC) phosphorylation, which results in contraction of smooth muscle and interaction of actin and myosin in nonmuscle cells
- The guanosine triphosphate (GTP)-bound, active form of RhoA (GTP
- RhoA) specifically interacted with the myosin-binding subunit (MBS) of myosin phosphatase, which regulates the extent of phosphorylation of MLC
- Rho-associated kinase (Rho-kinase), which is activated by GTP
- RhoA, phosphorylated MBS and consequently inactivated myosin phosphatase
- Overexpression of RhoA or activated RhoA in NIH 3T3 cells increased phosphorylation of MBS and MLC
- Thus, Rho appears to inhibit myosin phosphatase through the action of Rho-kinase
- Several transcript variants encoding different isoforms have been found for this gene.
Compare Similar Items
Show Difference
Antigen: MYPT1
Classification: Polyclonal
Conjugate: Unconjugated
Gene: PPP1R12A
Gene Alias: 1200015F06Rik; 130 kDa myosin-binding subunit of smooth muscle myosin phophatase; 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130); 130 kDa myosin-binding subunit of smooth muscle myosin phosphatase; 130 kDa regulatory subunit of myosin phosphatase; 133kDa myosin-binding subunit of smooth muscle myosin phosphatase (M133); 5730577I22Rik; AA792106; AV099298; D10Ertd625e; hypothetical protein; I79_016312; LOW QUALITY PROTEIN: protein phosphatase 1 regulatory subunit 12A; M110; M130; M130 of smooth muscle myosin phosphatase; MBS; MBSP; myosin binding subunit; myosin phosphatase target subunit 1; myosin phosphatase, target subunit 1; myosin phosphatase-targeting subunit 1; myosin-binding subunit of myosin phosphatase; Mypt1; PP-1M; PP1M M110 subunit; PP1M subunit M110; Ppp1r12a; Protein phosphatase 1 regulatory subunit 12A; protein phosphatase 1, regulatory (inhibitor) subunit 12A; protein phosphatase 1, regulatory subunit 12A; protein phosphatase 1M 110 kda regulatory subunit; protein phosphatase myosin-binding subunit; Protein phosphatase subunit 1M; serine/threonine protein phosphatase PP1 smooth muscle regulatory subunit M110; si:dkey-28j4.1; smooth muscle myosin phosphatase myosin-binding subunit; unm p82emcf; unm_p82emcf; zgc:110448; zgc:110448 protein
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 116670, 17931, 4659
Content And Storage: -20°C
Form: Lyophilized
Applications: Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: O14974, Q10728, Q9DBR7
Gene Symbols: PPP1R12A
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human PPP1R12A (1-40aa MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDD).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Non-human Primate, Rat
Product Type: Antibody
Isotype: IgG
Antigen: CPI-17
Classification: Polyclonal
Conjugate: Unconjugated
Gene: PPP1R14A
Gene Alias: 1110001M11Rik; 17 kDa PKC-potentiated inhibitory protein of PP1; 17-kDa PKC-potentiated inhibitory protein of PP1; 17-KDa protein; Cpi; CPI17; CPI-17; PKC-potentiated inhibitory protein of PP1; PPP1INL; PPP1R14A; Protein kinase C-potentiated inhibitor protein of 17 kDa; protein phosphatase 1 regulatory inhibitor subunit 14A; protein phosphatase 1 regulatory subunit 14A; protein phosphatase 1, regulatory (inhibitor) subunit 14A
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 114004, 68458, 94274
Content And Storage: -20°C
Form: Lyophilized
Applications: Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.: Q91VC7, Q96A00, Q99MC0
Gene Symbols: PPP1R14A
Immunogen: E.coli-derived human CPI17 alpha recombinant protein (Position: L30-Q126).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen: DARPP-32
Classification: Polyclonal
Conjugate: Unconjugated
Gene: Ppp1r1b
Gene Alias: AU040756; DARPP32; DARPP-32; dopamine- and cAMP-regulated neuronal phosphoprotein; dopamine and cAMP-regulated neuronal phosphoprotein 32; dopamine- and cAMP-regulated phosphoprotein DARPP-32; FLJ20940; IPPD; neuronal phosphoprotein DARPP-32; OTTHUMP00000164275; OTTHUMP00000164276; Ppp1r1b; PPR1B; protein pho; protein phosphatase 1 regulatory inhibitor subunit 1B; protein phosphatase 1 regulatory subunit 1B; protein phosphatase 1, regulatory (inhibitor) subunit 1B
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 19049, 360616, 84152
Content And Storage: -20°C
Form: Lyophilized
Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: Q60829, Q6J4I0, Q9UD71
Gene Symbols: Ppp1r1b
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human DARPP32 (1-36aa MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
