SFTPA1/SFTPA2 Polyclonal Antibody, Invitrogen™
Manufacturer: Thermo Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | PIPA579987-Each-of-1 | In Stock | ₹ 40,341.54 |
PIPA579987 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 40,341.54
GST (18%): ₹ 7,261.477
Total Price: ₹ 47,603.017
Antigen
SFTPA1/SFTPA2
Classification
Polyclonal
Conjugate
Unconjugated
Gene
Sftpa1
Gene Alias
35 kDa pulmonary surfactant-associated protein; Alveolar proteinosis protein; COLEC4; COLEC5; collectin 5; collectin-4; Collectin-5; FLJ50593; FLJ51913; FLJ61144; FLJ77898; FLJ79095; FLJ99559; MGC133365; MGC198590; PSAP; PSPA; PSP-A; pulmonary surfactant-associated protein A; Pulmonary surfactant-associated protein A1; pulmonary surfactant-associated protein A2; Sftp1; Sftp-1; Sftpa; Sftpa1; SFTPA1B; SFTPA2; SFTPA2B; Sftpl; SP-2A; SP-2A beta; SP-2A gamma; SPA; SP-A; SPA1; SP-A1; SP-A1 beta; SP-A1 delta; SP-A1 epsilon; SP-A1 gamma; SPA2; SP-A2; SP-A2 alpha; SP-A2 delta; SPAII; surfactant associated protein A; surfactant associated protein A1; surfactant protein A1; surfactant protein A1 variant AB'D' 6A; surfactant protein A1 variant AB'D' 6A2; surfactant protein A1 variant AB'D' 6A3; surfactant protein A1 variant AB'D' 6A4; surfactant protein A1 variant ACD' 6A; surfactant protein A1 variant ACD' 6A2; surfactant protein A1 variant ACD' 6A3; surfactant protein A1 variant ACD' 6A4; surfactant protein A1 variant AD' 6A; surfactant protein A1 variant AD' 6A2; surfactant protein A1 variant AD' 6A3; surfactant protein A1 variant AD' 6A4; surfactant protein A1B; surfactant protein A2; surfactant pulmonary associated protein A1; surfactant, pulmonary-associated protein A1; surfactant, pulmonary-associated protein A1A; surfactant, pulmonary-associated protein A1B; surfactant, pulmonary-associated protein A2A; Surfactant-associated protein 1 (pulmonary surfactant protein SP-A); Surfactant-associated protein 1 (pulmonary surfactant protein, SP-A)
Host Species
Rabbit
Purification Method
Antigen affinity chromatography
Regulatory Status
RUO
Gene ID (Entrez)
20387, 24773, 653509, 729238
Content And Storage
-20°C
Form
Lyophilized
Applications
Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot
Concentration
500 μg/mL
Formulation
PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.
P08427, P35242, Q8IWL1, Q8IWL2
Gene Symbols
Sftpa1, SFTPA2
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human SFTPA1/2 (206-237aa VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN).
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human, Mouse, Rat
Product Type
Antibody
Isotype
IgG
Related Products
Description
- Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL
- Surfactant protein A (SP-A) is synthesized and secreted by lung epithelial cells
- It belongs to group III of the family of C-type lectins and members of this group has overall structure consisting of multiple globular 'head' regions linked by triple-helical, collagen-like, strands
- This group also includes SP-D and the serum proteins mannan-binding protein, conglutinin and collectin-43, all of which have been shown to bind to the C1q receptor found on a wide variety of cells
- Both SP-D and SP-A have been shown to enhance oxygen radical production by alveolar macrophages
- The serum concentration is 45 ng/mL in healthy individuals.
Compare Similar Items
Show Difference
Antigen: SFTPA1/SFTPA2
Classification: Polyclonal
Conjugate: Unconjugated
Gene: Sftpa1
Gene Alias: 35 kDa pulmonary surfactant-associated protein; Alveolar proteinosis protein; COLEC4; COLEC5; collectin 5; collectin-4; Collectin-5; FLJ50593; FLJ51913; FLJ61144; FLJ77898; FLJ79095; FLJ99559; MGC133365; MGC198590; PSAP; PSPA; PSP-A; pulmonary surfactant-associated protein A; Pulmonary surfactant-associated protein A1; pulmonary surfactant-associated protein A2; Sftp1; Sftp-1; Sftpa; Sftpa1; SFTPA1B; SFTPA2; SFTPA2B; Sftpl; SP-2A; SP-2A beta; SP-2A gamma; SPA; SP-A; SPA1; SP-A1; SP-A1 beta; SP-A1 delta; SP-A1 epsilon; SP-A1 gamma; SPA2; SP-A2; SP-A2 alpha; SP-A2 delta; SPAII; surfactant associated protein A; surfactant associated protein A1; surfactant protein A1; surfactant protein A1 variant AB'D' 6A; surfactant protein A1 variant AB'D' 6A2; surfactant protein A1 variant AB'D' 6A3; surfactant protein A1 variant AB'D' 6A4; surfactant protein A1 variant ACD' 6A; surfactant protein A1 variant ACD' 6A2; surfactant protein A1 variant ACD' 6A3; surfactant protein A1 variant ACD' 6A4; surfactant protein A1 variant AD' 6A; surfactant protein A1 variant AD' 6A2; surfactant protein A1 variant AD' 6A3; surfactant protein A1 variant AD' 6A4; surfactant protein A1B; surfactant protein A2; surfactant pulmonary associated protein A1; surfactant, pulmonary-associated protein A1; surfactant, pulmonary-associated protein A1A; surfactant, pulmonary-associated protein A1B; surfactant, pulmonary-associated protein A2A; Surfactant-associated protein 1 (pulmonary surfactant protein SP-A); Surfactant-associated protein 1 (pulmonary surfactant protein, SP-A)
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 20387, 24773, 653509, 729238
Content And Storage: -20°C
Form: Lyophilized
Applications: Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: P08427, P35242, Q8IWL1, Q8IWL2
Gene Symbols: Sftpa1, SFTPA2
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SFTPA1/2 (206-237aa VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen: SFTPD
Classification: Polyclonal
Conjugate: Unconjugated
Gene: SFTPD
Gene Alias: AI573415; COLEC7; Collectin7; collectin-7; CP4; EGK_19692; Lung surfactant protein D; PSPD; PSP-D; PSP-D Surfactant protein D; pulmonary surfactant apoprotein; Pulmonary surfactant associated protein PSP-D; pulmonary surfactant protein D; pulmonary surfactant-associated protein D; SFTP 4; Sftp4; SFTPD; SPD; SP-D; surfactant associated protein D; Surfactant associated protein pulmonary 4; surfactant protein D; surfactant, pulmonary-associated protein D; surfactant-associated protein, pulmonary 4
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 25350, 6441
Content And Storage: -20°C
Form: Lyophilized
Applications: ELISA, Immunocytochemistry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: P35247, P35248
Gene Symbols: SFTPD
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Surfactant protein D (292-321aa RSAAENAALQQLVVAKNEAAFLSMTD SKTE).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Rat
Product Type: Antibody
Isotype: IgG
Antigen: Alpha Sarcoglycan
Classification: Polyclonal
Conjugate: Unconjugated
Gene: SGCA
Gene Alias: 50 kDa dystrophin-associated glycoprotein; 50DAG; 50kD DAG; adhalin; ADL; Alpha-sarcoglycan; alpha-SG; Asg; DAG2; DMDA2; Dystroglycan 2; Dystroglycan2; dystroglycan-2; LGMD2D; limb girdle muscular dystrophy 2D; sarcoglycan alpha; sarcoglycan, alpha (50kDa dystrophin-associated glycoprotein); sarcoglycan, alpha (dystrophin-associated glycoprotein); SCARMD1; SG alpha; SG-alpha; Sgca
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 20391, 303468, 6442
Content And Storage: -20°C
Form: Lyophilized
Applications: Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: P82350, Q16586
Gene Symbols: SGCA
Immunogen: E.coli-derived human SGCA recombinant protein (Position: Q24-H387).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
