Classification:
Polyclonal
Gene Alias:
ABC transporter, MHC 1; ABC transporter, MHC, 1; ABC17; ABCB2; ABP-278; ABP-280; ABP-280 homolog; Antigen peptide transporter 1; AOI; APT1; ATP dependent transport protein family member; ATP-binding cassette sub-family B member 2; ATP-binding cassette transporter, major histocompatibility complex, 1; ATP-binding cassette, sub-family B (MDR/TAP), member 2; beta-filamin; Cim; D6S114E; DAAP-57C1.5; FH1; filamin homolog 1; filamin-3; filamin-B; FLJ26666; FLJ41500; FLN1L; FLN-B; Ham1; Ham-1; Histocompatibility antigen modifier 1; LRS1; MTP1; Peptide supply factor 1; peptide transporter involved in antigen processing 1; Peptide transporter PSF1; peptide transporter TAP1; PSF1; PSF-1; Really interesting new gene 4 protein; RING4; SCT; TABP; TAP; tap i; TAP1; Tap-1; TAP1*0102N; TAP1N; Tap2; thyroid autoantigen; transporter 1 ABC (ATP binding cassette); transporter 1 ATP-binding cassette sub-family B; transporter 1, ABC (ATP binding cassette); transporter 1, ATP binding cassette subfamily B member; transporter 1, ATP-binding cassette, sub-family B (MDR/TAP); transporter associated with antigen processing; transporter associated with antigen processing 1; transporter, ABC, MHC, 1; transporter, ATP-binding cassette, major histocompatibility complex, 1; Y3
Purification Method:
Antigen affinity chromatography
Content And Storage:
-20°C
Applications:
Immunohistochemistry (Paraffin), Western Blot
Formulation:
PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.:
Q03518
Immunogen:
A synthetic peptide corresponding to a sequence in the middle region of human TAP1 (438-471aa RSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVN).
Primary or Secondary:
Primary