Classification:
Polyclonal
Gene Alias:
adapter-related protein complex 2 mu subunit, adapter-related protein complex 2 subunit mu, adaptin-mu2, Adaptor protein complex AP-2 subunit mu, adaptor related protein complex 2 mu 1 subunit, adaptor related protein complex 2 subunit mu 1, adaptor related protein complex 2, mu 1 subunit, adaptor-related protein complex 2 subunit mu, adaptor-related protein complex 2, mu 1 subunit, AP-2 complex subunit mu, AP-2 mu 2 chain, AP-2 mu chain, Ap2m1, AP50, Clapm1, clathrin adaptor complex AP2, mu subunit, Clathrin assembly protein complex 2 medium chain, clathrin assembly protein complex 2 mu medium chain, clathrin coat adaptor protein AP50, Clathrin coat assembly protein AP50, Clathrin coat-associated protein AP50, clathrin-associated/assembly/adaptor protein, medium 1, coat assembly protein complex 50 kD, HA2 50 kDA subunit, KIAA0109, mu2, Mu2-adaptin, Plasma membrane adaptor AP-2 50 kDa protein, plasma membrane adaptor AP-2 50kDA protein, QtsA-16673, unnamed protein product
Purification Method:
Affinity chromatography
Gene ID (Entrez):
116563, 1173, 11773
Content And Storage:
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Applications:
Western Blot
Formulation:
PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.:
P84091, P84092, Q96CW1
Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human AP2M1 (399-435aa LKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC).
Primary or Secondary:
Primary
Target Species:
Human, Mouse, Rat