COX4 Polyclonal Antibody, Invitrogen™
Manufacturer: Thermo Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | PIPA595519-Each-of-1 | In Stock | ₹ 44,705.10 |
PIPA595519 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 44,705.10
GST (18%): ₹ 8,046.918
Total Price: ₹ 52,752.018
Antigen
COX4
Classification
Polyclonal
Conjugate
Unconjugated
Gene
COX4I1
Gene Alias
AL024441, C16orf2, C16orf4, COX, cox iv, COX IV-1, Cox IV-2, Cox4, COX4 neighbor, Cox4-1, COX4-2, Cox4a, COX4AL, Cox4b, COX4I1, cox4i1.S, Cox4i2, COX4L2, COX4NB, coxiv, COXIV-1, CoxIV-2, cytochrome c oxidase polypeptide IV, Cytochrome c oxidase subunit 4 isoform 1, mitochondrial, cytochrome c oxidase subunit 4 isoform 2, mitochondrial, cytochrome c oxidase subunit 4I1, cytochrome c oxidase subunit 4I2, cytochrome c oxidase subunit IV, cytochrome c oxidase subunit IV isoform 1, cytochrome c oxidase subunit IV isoform 1 precursor, cytochrome c oxidase subunit IV isoform 1 S homeolog, cytochrome c oxidase subunit IV isoform 2, cytochrome c oxidase subunit IV isoform 2 (lung), cytochrome c oxidase subunit IV precursor EC 1.9.3.1, cytochrome c oxidase subunit IV-like 2, cytochrome c oxidase, subunit 4a, cytochrome c oxidase, subunit 4b, cytochrome c oxidase, subunit IV, cytochrome c oxidase, subunit IVa, cytochrome c oxidase, subunit IVb, cytochrome c oxydase subunit 4, dJ857M17.2, EMC8, ER membrane protein complex subunit 8, FAM158B, family with sequence similarity 158, member B, FLJ23483, hypothetical protein MGC73355, IV-1, mg:bb02d03, MGC72016, Neighbor of COX4, NOC4, Protein FAM158B, XELAEV_18024950mg, zgc:110058, zgc:73355
Host Species
Rabbit
Purification Method
Affinity chromatography
Regulatory Status
RUO
Gene ID (Entrez)
12857, 1327, 29445
Content And Storage
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Form
Lyophilized
Applications
ELISA, Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Paraffin), Western Blot
Concentration
500 μg/mL
Formulation
PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.
P10888, P13073, P19783
Gene Symbols
COX4I1
Immunogen
E.coli-derived human COX IV recombinant protein (Position: Q59-K169).
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human, Mouse, Rat
Product Type
Antibody
Isotype
IgG
Related Products
Description
- Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL
- Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain
- It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane
- The complex consists of 13 mitochondrial- and nuclear-encoded subunits
- The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex
- COX4 (COX4I1) is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Compare Similar Items
Show Difference
Antigen: COX4
Classification: Polyclonal
Conjugate: Unconjugated
Gene: COX4I1
Gene Alias: AL024441, C16orf2, C16orf4, COX, cox iv, COX IV-1, Cox IV-2, Cox4, COX4 neighbor, Cox4-1, COX4-2, Cox4a, COX4AL, Cox4b, COX4I1, cox4i1.S, Cox4i2, COX4L2, COX4NB, coxiv, COXIV-1, CoxIV-2, cytochrome c oxidase polypeptide IV, Cytochrome c oxidase subunit 4 isoform 1, mitochondrial, cytochrome c oxidase subunit 4 isoform 2, mitochondrial, cytochrome c oxidase subunit 4I1, cytochrome c oxidase subunit 4I2, cytochrome c oxidase subunit IV, cytochrome c oxidase subunit IV isoform 1, cytochrome c oxidase subunit IV isoform 1 precursor, cytochrome c oxidase subunit IV isoform 1 S homeolog, cytochrome c oxidase subunit IV isoform 2, cytochrome c oxidase subunit IV isoform 2 (lung), cytochrome c oxidase subunit IV precursor EC 1.9.3.1, cytochrome c oxidase subunit IV-like 2, cytochrome c oxidase, subunit 4a, cytochrome c oxidase, subunit 4b, cytochrome c oxidase, subunit IV, cytochrome c oxidase, subunit IVa, cytochrome c oxidase, subunit IVb, cytochrome c oxydase subunit 4, dJ857M17.2, EMC8, ER membrane protein complex subunit 8, FAM158B, family with sequence similarity 158, member B, FLJ23483, hypothetical protein MGC73355, IV-1, mg:bb02d03, MGC72016, Neighbor of COX4, NOC4, Protein FAM158B, XELAEV_18024950mg, zgc:110058, zgc:73355
Host Species: Rabbit
Purification Method: Affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 12857, 1327, 29445
Content And Storage: Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Form: Lyophilized
Applications: ELISA, Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.: P10888, P13073, P19783
Gene Symbols: COX4I1
Immunogen: E.coli-derived human COX IV recombinant protein (Position: Q59-K169).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen: Factor V
Classification: Polyclonal
Conjugate: Unconjugated
Gene: F5
Gene Alias: Ac2-120, Activated protein C cofactor, AI173222, Cf5, Cf-5, coagulation factor V, coagulation factor V (proaccelerin, labile factor), Coagulation factor V heavy chain, coagulation factor V jinjiang A2 domain, Coagulation factor V light chain, F5, Factor 5, factor V, factor V Leiden, Factor5, FVL, PCCF, Proaccelerin, labile factor, RPRGL1, THPH2
Host Species: Rabbit
Purification Method: Affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 2153
Content And Storage: Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Form: Lyophilized
Applications: Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.: P12259
Gene Symbols: F5
Immunogen: A synthetic peptide corresponding to a sequence of human Factor V (ESTVMATRKMHDRLEPEDEESDADYDYQNRLAAALGIR).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Product Type: Antibody
Isotype: IgG
Antigen: Fra1
Classification: Polyclonal
Conjugate: Unconjugated
Gene: FOSL1
Gene Alias: AW538199, FOS like 1, AP-1 trancription factor subunit, FOS like 1, AP-1 transcription factor subunit, FOS like antigen 1, Fosl1, FOS-like antigen 1, FOS-like antigen-1, fos-related antigen 1, FRA, Fra1, fra-1, HGNC:13718, LOW QUALITY PROTEIN: fos-related antigen 1
Host Species: Rabbit
Purification Method: Affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 8061
Content And Storage: Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Form: Lyophilized
Applications: Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.: P15407
Gene Symbols: FOSL1
Immunogen: A synthetic peptide corresponding to a sequence of human FRA1 (QPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPH).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Product Type: Antibody
Isotype: IgG
