NBP157033E
Novus Biologicals™ Glycerol Kinase Antibody Blocking Peptide
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP157033E-Each-of-1 | In Stock | ₹ 18,694.86 |
NBP157033E - Each of 1
In Stock
Quantity
1
Base Price: ₹ 18,694.86
GST (18%): ₹ 3,365.075
Total Price: ₹ 22,059.935
Gene ID (Entrez)
2710
Content And Storage
Store at -20 C. Avoid freeze-thaw cycles.
For Use With (Application)
This Peptide is Useful as a Blocking Peptide for NBP1-57033. This Synthetic Peptide is Designed for Use in an Antibody Competition Assay with Its Corresponding Antibody. Use of This Product in Any Other Assay Has Not Yet Been Tested. For Further Blocking Peptide Related Protocol, Click Here .
Gene Symbol
GK
Product Type
Glycerol Kinase
Regulatory Status
RUO - research use only
Species
Human
Formulation
Lyophilized with sterile distilled water.
Gene Alias
ATP:glycerol 3-phosphotransferase, EC 2.7.1.30, GK1, GKD, Glycerokinase, glycerol kinase
Molecular Weight (g/mol)
58kDa
Quantity
100 μg
Related Products
Description
- A blocking peptide from human Glycerol Kinase
- Source: Synthetic Amino Acid Sequence: (Accession #: NP_976325)MAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKS The Glycerol Kinase Blocking Peptide is derived from Synthetic
- The Glycerol Kinase Blocking Peptide has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 2710
Content And Storage: Store at -20 C. Avoid freeze-thaw cycles.
For Use With (Application): This Peptide is Useful as a Blocking Peptide for NBP1-57033. This Synthetic Peptide is Designed for Use in an Antibody Competition Assay with Its Corresponding Antibody. Use of This Product in Any Other Assay Has Not Yet Been Tested. For Further Blocking Peptide Related Protocol, Click Here .
Gene Symbol: GK
Product Type: Glycerol Kinase
Regulatory Status: RUO - research use only
Species: Human
Formulation: Lyophilized with sterile distilled water.
Gene Alias: ATP:glycerol 3-phosphotransferase, EC 2.7.1.30, GK1, GKD, Glycerokinase, glycerol kinase
Molecular Weight (g/mol): 58kDa
Quantity: 100 μg
Gene ID (Entrez):
2710
Content And Storage:
Store at -20 C. Avoid freeze-thaw cycles.
For Use With (Application):
This Peptide is Useful as a Blocking Peptide for NBP1-57033. This Synthetic Peptide is Designed for Use in an Antibody Competition Assay with Its Corresponding Antibody. Use of This Product in Any Other Assay Has Not Yet Been Tested. For Further Blocking Peptide Related Protocol, Click Here .
Gene Symbol:
GK
Product Type:
Glycerol Kinase
Regulatory Status:
RUO - research use only
Species:
Human
Formulation:
Lyophilized with sterile distilled water.
Gene Alias:
ATP:glycerol 3-phosphotransferase, EC 2.7.1.30, GK1, GKD, Glycerokinase, glycerol kinase
Molecular Weight (g/mol):
58kDa
Quantity:
100 μg
Gene ID (Entrez): 123207
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Species: __
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: chromosome 15 open reading frame 40, FLJ33606, hypothetical protein LOC123207, MGC29937
Molecular Weight (g/mol): __
Quantity: 100 μL
Gene ID (Entrez):
123207
Content And Storage:
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Species:
__
Formulation:
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias:
chromosome 15 open reading frame 40, FLJ33606, hypothetical protein LOC123207, MGC29937
Molecular Weight (g/mol):
__
Quantity:
100 μL
Gene ID (Entrez): 146779
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Species: __
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: EF-hand calcium binding domain 3, EF-hand calcium-binding domain-containing protein 3, FLJ25818, MGC126801, MGC126827
Molecular Weight (g/mol): __
Quantity: 100 μL
Gene ID (Entrez):
146779
Content And Storage:
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Species:
__
Formulation:
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias:
EF-hand calcium binding domain 3, EF-hand calcium-binding domain-containing protein 3, FLJ25818, MGC126801, MGC126827
Molecular Weight (g/mol):
__
Quantity:
100 μL
Gene ID (Entrez): 146779
Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Species: __
Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias: EF-hand calcium binding domain 3, EF-hand calcium-binding domain-containing protein 3, FLJ25818, MGC126801, MGC126827
Molecular Weight (g/mol): __
Quantity: 20 μL
Gene ID (Entrez):
146779
Content And Storage:
Store at -20C. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Species:
__
Formulation:
PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias:
EF-hand calcium binding domain 3, EF-hand calcium-binding domain-containing protein 3, FLJ25818, MGC126801, MGC126827
Molecular Weight (g/mol):
__
Quantity:
20 μL