NBP174183E
Novus Biologicals™ Wnt-3a Antibody Blocking Peptide
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP174183E-Each-of-1 | In Stock | ₹ 18,694.86 |
NBP174183E - Each of 1
In Stock
Quantity
1
Base Price: ₹ 18,694.86
GST (18%): ₹ 3,365.075
Total Price: ₹ 22,059.935
Gene ID (Entrez)
89780
Content And Storage
Store at -20 C. Avoid freeze-thaw cycles.
For Use With (Application)
This Peptide is Useful as a Blocking Peptide for NBP1-74183. This Synthetic Peptide is Designed for Use in an Antibody Competition Assay with Its Corresponding Antibody. Use of This Product in Any Other Assay Has Not Yet Been Tested. For Further Blocking Peptide Related Protocol, Click Here .
Gene Symbol
WNT3A
Quantity
100 μg
Species
Mouse
Formulation
Lyophilized from sterile distilled water.
Gene Alias
MGC119418, MGC119419, MGC119420, protein Wnt-3 A, wingless-type MMTV integration site family, member 3 A
Product Type
Wnt-3a
Regulatory Status
RUO - research use only
Related Products
Description
- A blocking peptide from mouse WNT3A
- Source: Synthetic Amino Acid Sequence: (Accession #: NP_033548) IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA
- The Wnt-3a Blocking Peptide is derived from Synthetic
- The Wnt-3a Blocking Peptide has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 89780
Content And Storage: Store at -20 C. Avoid freeze-thaw cycles.
For Use With (Application): This Peptide is Useful as a Blocking Peptide for NBP1-74183. This Synthetic Peptide is Designed for Use in an Antibody Competition Assay with Its Corresponding Antibody. Use of This Product in Any Other Assay Has Not Yet Been Tested. For Further Blocking Peptide Related Protocol, Click Here .
Gene Symbol: WNT3A
Quantity: 100 μg
Species: Mouse
Formulation: Lyophilized from sterile distilled water.
Gene Alias: MGC119418, MGC119419, MGC119420, protein Wnt-3 A, wingless-type MMTV integration site family, member 3 A
Product Type: Wnt-3a
Regulatory Status: RUO - research use only
Gene ID (Entrez):
89780
Content And Storage:
Store at -20 C. Avoid freeze-thaw cycles.
For Use With (Application):
This Peptide is Useful as a Blocking Peptide for NBP1-74183. This Synthetic Peptide is Designed for Use in an Antibody Competition Assay with Its Corresponding Antibody. Use of This Product in Any Other Assay Has Not Yet Been Tested. For Further Blocking Peptide Related Protocol, Click Here .
Gene Symbol:
WNT3A
Quantity:
100 μg
Species:
Mouse
Formulation:
Lyophilized from sterile distilled water.
Gene Alias:
MGC119418, MGC119419, MGC119420, protein Wnt-3 A, wingless-type MMTV integration site family, member 3 A
Product Type:
Wnt-3a
Regulatory Status:
RUO - research use only
Gene ID (Entrez): 9464
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Quantity: 100 μL
Species: __
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: BHLHA26, bHLHa26MGC125303, dHAND, DHAND2, FLJ16260, heart and neural crest derivatives expressed 2, heart, autonomic nervous system and neural crestderivatives-expressed protein 2, Hed, MGC125304, Thing2
Product Type: __
Regulatory Status: RUO
Gene ID (Entrez):
9464
Content And Storage:
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Quantity:
100 μL
Species:
__
Formulation:
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias:
BHLHA26, bHLHa26MGC125303, dHAND, DHAND2, FLJ16260, heart and neural crest derivatives expressed 2, heart, autonomic nervous system and neural crestderivatives-expressed protein 2, Hed, MGC125304, Thing2
Product Type:
__
Regulatory Status:
RUO
Gene ID (Entrez): 9464
Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Quantity: 20 μL
Species: __
Formulation: PBS & 2% Sucrose. with No Preservative
Gene Alias: BHLHA26, bHLHa26MGC125303, dHAND, DHAND2, FLJ16260, heart and neural crest derivatives expressed 2, heart, autonomic nervous system and neural crestderivatives-expressed protein 2, Hed, MGC125304, Thing2
Product Type: __
Regulatory Status: RUO
Gene ID (Entrez):
9464
Content And Storage:
Store at -20C. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Quantity:
20 μL
Species:
__
Formulation:
PBS & 2% Sucrose. with No Preservative
Gene Alias:
BHLHA26, bHLHa26MGC125303, dHAND, DHAND2, FLJ16260, heart and neural crest derivatives expressed 2, heart, autonomic nervous system and neural crestderivatives-expressed protein 2, Hed, MGC125304, Thing2
Product Type:
__
Regulatory Status:
RUO
Gene ID (Entrez): 6536
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Quantity: 100 μL
Species: __
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: DKFZp547A1118, GlyT1, GlyT-1, GLYT1glyT-1, sodium- and chloride-dependent glycine transporter 1, solute carrier family 6 (neurotransmitter transporter, glycine), member 9, Solute carrier family 6 member 9
Product Type: __
Regulatory Status: RUO
Gene ID (Entrez):
6536
Content And Storage:
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Quantity:
100 μL
Species:
__
Formulation:
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias:
DKFZp547A1118, GlyT1, GlyT-1, GLYT1glyT-1, sodium- and chloride-dependent glycine transporter 1, solute carrier family 6 (neurotransmitter transporter, glycine), member 9, Solute carrier family 6 member 9
Product Type:
__
Regulatory Status:
RUO