NBP185957PE

Novus Biologicals™ RABGGTB Recombinant Protein Antigen

Manufacturer: Novus Biologicals™

Select a Size

Pack Size SKU Availability Price
Each of 1 NBP185957PE-Each-of-1 In Stock ₹ 30,159.90

NBP185957PE - Each of 1

₹ 30,159.90

In Stock

Quantity

1

Base Price: ₹ 30,159.90

GST (18%): ₹ 5,428.782

Total Price: ₹ 35,588.682

Gene ID (Entrez)

5876

Purification Method

Chromatography

Concentration

0.5mg/mL

Formulation

PBS and 1M Urea, pH 7.4.

Gene Symbol

RABGGTB

Molecular Weight (g/mol)

27kDa

Quantity

0.1mL

Source

E.Coli

Immunogen

MGTPQKDVIIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGIYWGLTVMDLMGQLHRMNREEILAFIKSCQHECGGIS

Species

Human

Purity

>80%

Content And Storage

Store at -20°C. Avoid freeze-thaw cycles.

For Use With (Application)

Blocking/Neutralizing, Control

Label Type

Unlabeled

Product Type

RABGGTB

Regulatory Status

RUO

Specific Reactivity

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85957. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

Description

  • A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RABGGTB
  • The RABGGTB Recombinant Protein Antigen is derived from E
  • coli
  • The RABGGTB Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

SAFETY INFORMATION

  • ShelfLife : 365

Compare Similar Items

Show Difference

Img

Novus Biologicals™

NBP185957PE

--


Gene ID (Entrez):
5876

Purification Method:
Chromatography

Concentration:
0.5mg/mL

Formulation:
PBS and 1M Urea, pH 7.4.

Gene Symbol:
RABGGTB

Molecular Weight (g/mol):
27kDa

Quantity:
0.1mL

Source:
E.Coli

Immunogen:
MGTPQKDVIIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGIYWGLTVMDLMGQLHRMNREEILAFIKSCQHECGGIS

Species:
Human

Purity:
>80%

Content And Storage:
Store at -20°C. Avoid freeze-thaw cycles.

For Use With (Application):
Blocking/Neutralizing, Control

Label Type:
Unlabeled

Product Type:
RABGGTB

Regulatory Status:
RUO

Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85957. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

Img

Novus Biologicals™

NBP185958PE

--


Gene ID (Entrez):
10388

Purification Method:
Chromatography

Concentration:
0.5mg/mL

Formulation:
PBS and 1M Urea, pH 7.4.

Gene Symbol:
SYCP2

Molecular Weight (g/mol):
28kDa

Quantity:
0.1mL

Source:
E.Coli

Immunogen:
GKKALADAQIPYSAVDQACVGYVFGDSTCGQRAIYHSLGMTGIPIINVNNNCATGSTALFMARQLIQGGVAECVLALGFEKMSKGSLGIKFSDRTIPTDKH

Species:
Human

Purity:
>80%

Content And Storage:
Store at -20°C. Avoid freeze-thaw cycles.

For Use With (Application):
Blocking/Neutralizing, Control

Label Type:
Unlabeled

Product Type:
SCP2

Regulatory Status:
RUO

Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85958. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

Img

Fischer Scientific

NBP185959

--


Gene ID (Entrez):
2207

Purification Method:
Affinity Purified

Concentration:
__

Formulation:
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide

Gene Symbol:
__

Molecular Weight (g/mol):
__

Quantity:
0.1 mL

Source:
__

Immunogen:
This antibody was developed against Recombinant Protein corresponding to amino acids:KIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ

Species:
__

Purity:
__

Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Use With (Application):
__

Label Type:
__

Product Type:
__

Regulatory Status:
RUO

Specific Reactivity:
__

Img

Novus Biologicals™

NBP185959PE

--


Gene ID (Entrez):
2207

Purification Method:
Chromatography

Concentration:
0.5mg/mL

Formulation:
PBS and 1M Urea, pH 7.4.

Gene Symbol:
FCER1G

Molecular Weight (g/mol):
22kDa

Quantity:
0.1mL

Source:
E.Coli

Immunogen:
KIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ

Species:
Human

Purity:
>80%

Content And Storage:
Store at -20°C. Avoid freeze-thaw cycles.

For Use With (Application):
Blocking/Neutralizing, Control

Label Type:
Unlabeled

Product Type:
FCER1G

Regulatory Status:
RUO

Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85959. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml