NBP254939PE
Novus Biologicals™ RPL7L1 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP254939PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP254939PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
285855
Common Name
RPL7L1 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
dJ475N16.4,60S ribosomal protein L7-like 1, MGC62004, ribosomal protein L7-like 1
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
RPL7L1
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51675. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RPL7L1
- Source: E.coli Amino Acid Sequence: HEIAFPGKHFQEISWFLCPFHLSVARHATKNRVGFLKEMGTPGYRGERINQLIRQLN The RPL7L1 Recombinant Protein Antigen is derived from E
- coli
- The RPL7L1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 285855
Common Name: RPL7L1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: dJ475N16.4,60S ribosomal protein L7-like 1, MGC62004, ribosomal protein L7-like 1
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: RPL7L1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51675. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
285855
Common Name:
RPL7L1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
dJ475N16.4,60S ribosomal protein L7-like 1, MGC62004, ribosomal protein L7-like 1
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
RPL7L1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51675. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 22803
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: 5'-3' exoribonuclease 2, DHM1-like protein, Dhm1-like protein (mouse homolog), DHP protein, EC 3.1.13, EC 3.1.13.-
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
22803
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
5'-3' exoribonuclease 2, DHM1-like protein, Dhm1-like protein (mouse homolog), DHP protein, EC 3.1.13, EC 3.1.13.-
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 8848
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Cerebral protein 2, KIAA1994, MGC17597, Regulatory protein TSC-22, RP11-269C23.2, TGFB1I4, TGFB-stimulated clone 22 homolog, transforming growth factor beta 1 induced transcript 4, Transforming growth factor beta-1-induced transcript 4 protein, transforming growth factor beta-stimulated protein TSC-22, TSC22 domain family 1, TSC22 domain family protein 1, TSC22 domain family, member 1, TSC22DKFZp686O19206
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
8848
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Cerebral protein 2, KIAA1994, MGC17597, Regulatory protein TSC-22, RP11-269C23.2, TGFB1I4, TGFB-stimulated clone 22 homolog, transforming growth factor beta 1 induced transcript 4, Transforming growth factor beta-1-induced transcript 4 protein, transforming growth factor beta-stimulated protein TSC-22, TSC22 domain family 1, TSC22 domain family protein 1, TSC22 domain family, member 1, TSC22DKFZp686O19206
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 8848
Common Name: TSC22/TSC22D1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: Cerebral protein 2, KIAA1994, MGC17597, Regulatory protein TSC-22, RP11-269C23.2, TGFB1I4, TGFB-stimulated clone 22 homolog, transforming growth factor beta 1 induced transcript 4, Transforming growth factor beta-1-induced transcript 4 protein, transformi
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: TSC22D1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53609. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
8848
Common Name:
TSC22/TSC22D1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
Cerebral protein 2, KIAA1994, MGC17597, Regulatory protein TSC-22, RP11-269C23.2, TGFB1I4, TGFB-stimulated clone 22 homolog, transforming growth factor beta 1 induced transcript 4, Transforming growth factor beta-1-induced transcript 4 protein, transformi
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
TSC22D1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53609. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml