NBP255109PE
Novus Biologicals™ SPPL3 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255109PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP255109PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
121665
Common Name
SPPL3 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
DKFZp586C1324, EC 3.4.23.-, IMP-2, IMP2MGC126674, Intramembrane protease 2, MDHV1887, MGC126676, MGC90402, Presenilin-like protein 4, PRO4332, PSL4, signal peptide peptidase 3, signal peptide peptidase-like 3, SPP-like 3
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
SPPL3
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51045. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SPPL3
- Source: E.coli Amino Acid Sequence: FNSNVMVKVATQPADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSSTG The SPPL3 Recombinant Protein Antigen is derived from E
- coli
- The SPPL3 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 121665
Common Name: SPPL3 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: DKFZp586C1324, EC 3.4.23.-, IMP-2, IMP2MGC126674, Intramembrane protease 2, MDHV1887, MGC126676, MGC90402, Presenilin-like protein 4, PRO4332, PSL4, signal peptide peptidase 3, signal peptide peptidase-like 3, SPP-like 3
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SPPL3
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51045. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
121665
Common Name:
SPPL3 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
DKFZp586C1324, EC 3.4.23.-, IMP-2, IMP2MGC126674, Intramembrane protease 2, MDHV1887, MGC126676, MGC90402, Presenilin-like protein 4, PRO4332, PSL4, signal peptide peptidase 3, signal peptide peptidase-like 3, SPP-like 3
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SPPL3
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51045. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 4354
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: 55 kDa erythrocyte membrane protein, AAG12, EC 2.7.11, Membrane protein, palmitoylated 1, membrane protein, palmitoylated 1, 55kDa, MRG1, palmitoylated erythrocyte membrane protein, PEMPpalmitoylated 1 (55kD)
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
4354
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
55 kDa erythrocyte membrane protein, AAG12, EC 2.7.11, Membrane protein, palmitoylated 1, membrane protein, palmitoylated 1, 55kDa, MRG1, palmitoylated erythrocyte membrane protein, PEMPpalmitoylated 1 (55kD)
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 8851
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CDK5 activator 1, CDK5P35, CDK5R, cyclin-dependent kinase 5 activator 1, Cyclin-dependent kinase 5 regulatory subunit 1, cyclin-dependent kinase 5, regulatory subunit 1 (p35), MGC33831, NCK5A, neuronal CDK5 activator, p23, p25, p35, p35nck5a, regulatory partner for CDK5 kinase, tau protein kinase II 23kDa subunit, TPKII regulatory subunit
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
8851
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CDK5 activator 1, CDK5P35, CDK5R, cyclin-dependent kinase 5 activator 1, Cyclin-dependent kinase 5 regulatory subunit 1, cyclin-dependent kinase 5, regulatory subunit 1 (p35), MGC33831, NCK5A, neuronal CDK5 activator, p23, p25, p35, p35nck5a, regulatory partner for CDK5 kinase, tau protein kinase II 23kDa subunit, TPKII regulatory subunit
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 8851
Common Name: CDK5 Activator 1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: CDK5 activator 1, CDK5P35, CDK5R, cyclin-dependent kinase 5 activator 1, Cyclin-dependent kinase 5 regulatory subunit 1, cyclin-dependent kinase 5, regulatory subunit 1 (p35), MGC33831, NCK5A, neuronal CDK5 activator, p23, p25, p35, p35nck5a, regulatory p
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: −20°C, avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: CDK5R1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51019. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
8851
Common Name:
CDK5 Activator 1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
CDK5 activator 1, CDK5P35, CDK5R, cyclin-dependent kinase 5 activator 1, Cyclin-dependent kinase 5 regulatory subunit 1, cyclin-dependent kinase 5, regulatory subunit 1 (p35), MGC33831, NCK5A, neuronal CDK5 activator, p23, p25, p35, p35nck5a, regulatory p
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
−20°C, avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
CDK5R1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51019. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml