NBP255254PE
Novus Biologicals™ UPF3A Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255254PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP255254PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
65110
Common Name
UPF3A Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
HUPF3A, Nonsense mRNA reducing factor 3A, regulator of nonsense transcripts 3A, RENT3AUp-frameshift suppressor 3 homolog A, UPF3 regulator of nonsense transcripts homolog A (yeast), UPF3hUpf3
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
UPF3A
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52474. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UPF3A
- Source: E.coli Amino Acid Sequence: FLETYCVEEEKTSANPETLLGEMEAKTRELIARRTTPLLEYIKNRKLEKQR The UPF3A Recombinant Protein Antigen is derived from E
- coli
- The UPF3A Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 65110
Common Name: UPF3A Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: HUPF3A, Nonsense mRNA reducing factor 3A, regulator of nonsense transcripts 3A, RENT3AUp-frameshift suppressor 3 homolog A, UPF3 regulator of nonsense transcripts homolog A (yeast), UPF3hUpf3
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: UPF3A
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52474. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
65110
Common Name:
UPF3A Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
HUPF3A, Nonsense mRNA reducing factor 3A, regulator of nonsense transcripts 3A, RENT3AUp-frameshift suppressor 3 homolog A, UPF3 regulator of nonsense transcripts homolog A (yeast), UPF3hUpf3
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
UPF3A
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52474. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 4690
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: cytoplasmic protein NCK1, MGC12668, NCK adaptor protein 1melanoma NCK protein, nck-1, NCKalpha, NCKNCK tyrosine kinase, non-catalytic region of tyrosine kinase, SH2/SH3 adaptor protein NCK-alpha
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
4690
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
cytoplasmic protein NCK1, MGC12668, NCK adaptor protein 1melanoma NCK protein, nck-1, NCKalpha, NCKNCK tyrosine kinase, non-catalytic region of tyrosine kinase, SH2/SH3 adaptor protein NCK-alpha
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 4690
Common Name: NCK1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: cytoplasmic protein NCK1, MGC12668, NCK adaptor protein 1melanoma NCK protein, nck-1, NCKalpha, NCKNCK tyrosine kinase, non-catalytic region of tyrosine kinase, SH2/SH3 adaptor protein NCK-alpha
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: NCK1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49871. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
4690
Common Name:
NCK1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
cytoplasmic protein NCK1, MGC12668, NCK adaptor protein 1melanoma NCK protein, nck-1, NCKalpha, NCKNCK tyrosine kinase, non-catalytic region of tyrosine kinase, SH2/SH3 adaptor protein NCK-alpha
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
NCK1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49871. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 2176
Common Name: FANCC Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: FA3, FACCProtein FACC, FACFanconi anemia group C protein, Fanconi anemia, complementation group C, FLJ14675
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: FANCC
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49872. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
2176
Common Name:
FANCC Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
FA3, FACCProtein FACC, FACFanconi anemia group C protein, Fanconi anemia, complementation group C, FLJ14675
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
FANCC
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49872. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml