NBP256283PE
Novus Biologicals™ P2Y10/P2RY10 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256283PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP256283PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
27334
Common Name
P2Y10/P2RY10 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
G-protein coupled purinergic receptor P2Y10, P2Y purinoceptor 10, P2Y10P2Y-like receptor, purinergic receptor P2Y, G-protein coupled, 10, putative P2Y purinoceptor 10
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
P2RY10
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52902. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human P2Y10/P2RY10
- Source: E.coli Amino Acid Sequence: MASEFRDQLSRHGSSVTRSRLMSKESGSSMIG The P2Y10/P2RY10 Recombinant Protein Antigen is derived from E
- coli
- The P2Y10/P2RY10 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 27334
Common Name: P2Y10/P2RY10 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: G-protein coupled purinergic receptor P2Y10, P2Y purinoceptor 10, P2Y10P2Y-like receptor, purinergic receptor P2Y, G-protein coupled, 10, putative P2Y purinoceptor 10
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: P2RY10
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52902. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
27334
Common Name:
P2Y10/P2RY10 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
G-protein coupled purinergic receptor P2Y10, P2Y purinoceptor 10, P2Y10P2Y-like receptor, purinergic receptor P2Y, G-protein coupled, 10, putative P2Y purinoceptor 10
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
P2RY10
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52902. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 283629
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: C14orf20, EC 2.7.11, EC 2.7.11.1, MGC133264, serine/threonine kinase 22E, Serine/threonine-protein kinase 22E, STK22E, Testis-specific kinase 4, testis-specific serine kinase 4, testis-specific serine/threonine-protein kinase 4, TSK-4, TSSK-4, TSSK5TSK4
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
283629
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
C14orf20, EC 2.7.11, EC 2.7.11.1, MGC133264, serine/threonine kinase 22E, Serine/threonine-protein kinase 22E, STK22E, Testis-specific kinase 4, testis-specific serine kinase 4, testis-specific serine/threonine-protein kinase 4, TSK-4, TSSK-4, TSSK5TSK4
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 283629
Common Name: TSSK4 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: C14orf20, EC 2.7.11, EC 2.7.11.1, MGC133264, serine/threonine kinase 22E, Serine/threonine-protein kinase 22E, STK22E, Testis-specific kinase 4, testis-specific serine kinase 4, testis-specific serine/threonine-protein kinase 4, TSK-4, TSSK-4, TSSK5TSK4
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: TSSK4
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50452. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
283629
Common Name:
TSSK4 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
C14orf20, EC 2.7.11, EC 2.7.11.1, MGC133264, serine/threonine kinase 22E, Serine/threonine-protein kinase 22E, STK22E, Testis-specific kinase 4, testis-specific serine kinase 4, testis-specific serine/threonine-protein kinase 4, TSK-4, TSSK-4, TSSK5TSK4
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
TSSK4
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50452. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 5068
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: hepatocarcinoma-intestine-pancreas, HIPpancreatitis-associated protein, Human proislet peptide, pancreatic beta cell growth factor, Pancreatitis-associated protein 1, PAP homologous protein, PAP1FLJ18565, PAPPAP-H, PBCGF, proliferation-inducing protein 34, proliferation-inducing protein 42, Reg III-alpha, REG3, REG-3-alpha, regenerating islet-derived 3 alpha, regenerating islet-derived protein 3-alpha, Regenerating islet-derived protein III-alpha, REG-III
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
5068
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
hepatocarcinoma-intestine-pancreas, HIPpancreatitis-associated protein, Human proislet peptide, pancreatic beta cell growth factor, Pancreatitis-associated protein 1, PAP homologous protein, PAP1FLJ18565, PAPPAP-H, PBCGF, proliferation-inducing protein 34, proliferation-inducing protein 42, Reg III-alpha, REG3, REG-3-alpha, regenerating islet-derived 3 alpha, regenerating islet-derived protein 3-alpha, Regenerating islet-derived protein III-alpha, REG-III
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__