NBP256459PE
Novus Biologicals™ DOK6 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256459PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP256459PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
220164
Common Name
DOK6 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
docking protein 5-like, docking protein 6, DOK5L, Downstream of tyrosine kinase 6, HsT3226, MGC20785
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
DOK6
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52679. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DOK6
- Source: E.coli Amino Acid Sequence: EQHERLMLEMEQKARLQTSLTEPMTLSKSISLPRSAYW The DOK6 Recombinant Protein Antigen is derived from E
- coli
- The DOK6 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 220164
Common Name: DOK6 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: docking protein 5-like, docking protein 6, DOK5L, Downstream of tyrosine kinase 6, HsT3226, MGC20785
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: DOK6
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52679. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
220164
Common Name:
DOK6 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
docking protein 5-like, docking protein 6, DOK5L, Downstream of tyrosine kinase 6, HsT3226, MGC20785
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
DOK6
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52679. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 1495
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Alpha E-catenin, alpha-catenin, alpha-E-catenin, alphaE-catenin, Cadherin-associated protein, CAP102, catenin (cadherin-associated protein), alpha 1 (102kD), catenin (cadherin-associated protein), alpha 1, 102kDa, catenin alpha-1, FLJ36832, FLJ52416, Renal carcinoma antigen NY-REN-13
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
1495
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Alpha E-catenin, alpha-catenin, alpha-E-catenin, alphaE-catenin, Cadherin-associated protein, CAP102, catenin (cadherin-associated protein), alpha 1 (102kD), catenin (cadherin-associated protein), alpha 1, 102kDa, catenin alpha-1, FLJ36832, FLJ52416, Renal carcinoma antigen NY-REN-13
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 1495
Common Name: Catenin alpha 1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: Alpha E-catenin, alpha-catenin, alpha-E-catenin, alphaE-catenin, Cadherin-associated protein, CAP102, catenin (cadherin-associated protein), alpha 1 (102kD), catenin (cadherin-associated protein), alpha 1, 102kDa, catenin alpha-1, FLJ36832, FLJ52416, Rena
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: CTNNA1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50563. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
1495
Common Name:
Catenin alpha 1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
Alpha E-catenin, alpha-catenin, alpha-E-catenin, alphaE-catenin, Cadherin-associated protein, CAP102, catenin (cadherin-associated protein), alpha 1 (102kD), catenin (cadherin-associated protein), alpha 1, 102kDa, catenin alpha-1, FLJ36832, FLJ52416, Rena
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
CTNNA1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50563. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 9512
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Beta-MPP, EC 3.4.24.64, mitochondrial processing peptidase beta subunit, mitochondrial-processing peptidase subunit beta, MPPBMPP11, MPPP52, P-52, peptidase (mitochondrial processing) beta
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
9512
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Beta-MPP, EC 3.4.24.64, mitochondrial processing peptidase beta subunit, mitochondrial-processing peptidase subunit beta, MPPBMPP11, MPPP52, P-52, peptidase (mitochondrial processing) beta
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__