NBP256506PE
Novus Biologicals™ MICB Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256506PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP256506PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
4277
Common Name
MICB Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
MHC class I chain-related protein B, MHC class I mic-B antigen, MHC class I polypeptide-related sequence B, MIC-B, PERB11.2MHC class I-like molecule PERB11.2-IMX, stress inducible class I homolog
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
MICB
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52790. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MICB
- Source: E.coli Amino Acid Sequence: CKKKTSAAEGPELVSLQVLDQHPVGTGDHRDAAQLGFQPLMSATGSTGSTE The MICB Recombinant Protein Antigen is derived from E
- coli
- The MICB Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 4277
Common Name: MICB Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: MHC class I chain-related protein B, MHC class I mic-B antigen, MHC class I polypeptide-related sequence B, MIC-B, PERB11.2MHC class I-like molecule PERB11.2-IMX, stress inducible class I homolog
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: MICB
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52790. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
4277
Common Name:
MICB Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
MHC class I chain-related protein B, MHC class I mic-B antigen, MHC class I polypeptide-related sequence B, MIC-B, PERB11.2MHC class I-like molecule PERB11.2-IMX, stress inducible class I homolog
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
MICB
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52790. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 85315
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: C6orf33Lysosomal membrane protein in brain 1, LMPB1FLJ32521, lysosomal membrane protein in brain-1, membrane progestin receptor beta, mPR beta, MPRBFLJ46206, Progestin and adipoQ receptor family member 8, progestin and adipoQ receptor family member VIIIchromosome 6 open reading frame 33
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
85315
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
C6orf33Lysosomal membrane protein in brain 1, LMPB1FLJ32521, lysosomal membrane protein in brain-1, membrane progestin receptor beta, mPR beta, MPRBFLJ46206, Progestin and adipoQ receptor family member 8, progestin and adipoQ receptor family member VIIIchromosome 6 open reading frame 33
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 81832
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor classA domains protein 1, BTCL1BCTL1neuropilin and tolloid-like protein 1, FLJ41325, neuropilin (NRP) and tolloid (TLL)-like 1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
81832
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor classA domains protein 1, BTCL1BCTL1neuropilin and tolloid-like protein 1, FLJ41325, neuropilin (NRP) and tolloid (TLL)-like 1
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 8574
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: AFAR1, AFARAFB1-AR1, AFB1 aldehyde reductase 1, AFB1-AR 1, aflatoxin B1 aldehyde reductase member 2, aflatoxin beta1 aldehyde reductase, AKR7, aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase), Aldoketoreductase 7, EC 1.1.1.n11, SSA reductase, Succinic semialdehyde reductase
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
8574
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
AFAR1, AFARAFB1-AR1, AFB1 aldehyde reductase 1, AFB1-AR 1, aflatoxin B1 aldehyde reductase member 2, aflatoxin beta1 aldehyde reductase, AKR7, aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase), Aldoketoreductase 7, EC 1.1.1.n11, SSA reductase, Succinic semialdehyde reductase
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__