NBP256781PE
Novus Biologicals™ Synaptotagmin 13 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256781PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP256781PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
57586
Common Name
Synaptotagmin 13 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
synaptotagmin XIIIKIAA1427synaptotagmin-13, sytXIII
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
SYT13
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52111. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Synaptotagmin 13
- Source: E.coli Amino Acid Sequence: KDVSVKVTLKHQARKLKKKQTKRAKHKINPVWNEMIMFELPDDLLQASSVE The Synaptotagmin 13 Recombinant Protein Antigen is derived from E
- coli
- The Synaptotagmin 13 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 57586
Common Name: Synaptotagmin 13 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: synaptotagmin XIIIKIAA1427synaptotagmin-13, sytXIII
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SYT13
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52111. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
57586
Common Name:
Synaptotagmin 13 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
synaptotagmin XIIIKIAA1427synaptotagmin-13, sytXIII
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SYT13
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52111. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 55252
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: additional sex combs like 2 (Drosophila), Additional sex combs-like protein 2, ASXH2polycomb group protein ASXH2, FLJ10898, KIAA1685DKFZp686C1968, putative Polycomb group protein ASXL2
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
55252
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
additional sex combs like 2 (Drosophila), Additional sex combs-like protein 2, ASXH2polycomb group protein ASXH2, FLJ10898, KIAA1685DKFZp686C1968, putative Polycomb group protein ASXL2
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 55252
Common Name: ASXL2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: additional sex combs like 2 (Drosophila), Additional sex combs-like protein 2, ASXH2polycomb group protein ASXH2, FLJ10898, KIAA1685DKFZp686C1968, putative Polycomb group protein ASXL2
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ASXL2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51254. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
55252
Common Name:
ASXL2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
additional sex combs like 2 (Drosophila), Additional sex combs-like protein 2, ASXH2polycomb group protein ASXH2, FLJ10898, KIAA1685DKFZp686C1968, putative Polycomb group protein ASXL2
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ASXL2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51254. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 6744
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Cleavage signal-1 protein, CS1, CS-1DKFZp313O1039, FLJ45996, KIAA1927, Ki-ras-induced actin-interacting protein, KRAPDKFZp779G0129, SPAG13, sperm specific antigen 2, sperm-specific antigen 2
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
6744
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Cleavage signal-1 protein, CS1, CS-1DKFZp313O1039, FLJ45996, KIAA1927, Ki-ras-induced actin-interacting protein, KRAPDKFZp779G0129, SPAG13, sperm specific antigen 2, sperm-specific antigen 2
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__