NBP256892PE
Novus Biologicals™ SYT15 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256892PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP256892PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
83849
Common Name
SYT15 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
synaptotagmin-15, CHR10SYT, synaptotagmin XV, sytXV
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
SYT15
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50986. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SYT15
- Source: E.coli Amino Acid Sequence: QFDEHFIFQVSSKTITQRVLKFSVYHVDRQRKHQLLGQVLFPLKNETLVGDCRRVIWRDLEAESL The SYT15 Recombinant Protein Antigen is derived from E
- coli
- The SYT15 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 83849
Common Name: SYT15 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: synaptotagmin-15, CHR10SYT, synaptotagmin XV, sytXV
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SYT15
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50986. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
83849
Common Name:
SYT15 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
synaptotagmin-15, CHR10SYT, synaptotagmin XV, sytXV
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SYT15
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50986. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 4072
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: 17-1A, 323/A3, ACSTD1, antigen identified by monoclonal AUA1, CD326 antigen, Cell surface glycoprotein Trop-1, chromosome 4, surface marker (35kD glycoprotein), DIAR5, EGP, EGP-2, EGP314, EGP40, EpCAM, epithelial cell adhesion molecule, Epithelial cell surface antigen, Epithelial glycoprotein, Epithelial glycoprotein 314, ESA, GA733-2EGP34, hEGP314, HNPCC8, KS 1/4 antigen, KS1/4, KSAHEA125, M1S2, M4S1Ly74, Major gastrointestinal tumor-associated protein GA733-2, MIC18MH99, MOC31, TACST-1, TACSTD1, TROP1CD326, Tumor-associated calcium signal transducer 1CO-17A
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
4072
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
17-1A, 323/A3, ACSTD1, antigen identified by monoclonal AUA1, CD326 antigen, Cell surface glycoprotein Trop-1, chromosome 4, surface marker (35kD glycoprotein), DIAR5, EGP, EGP-2, EGP314, EGP40, EpCAM, epithelial cell adhesion molecule, Epithelial cell surface antigen, Epithelial glycoprotein, Epithelial glycoprotein 314, ESA, GA733-2EGP34, hEGP314, HNPCC8, KS 1/4 antigen, KS1/4, KSAHEA125, M1S2, M4S1Ly74, Major gastrointestinal tumor-associated protein GA733-2, MIC18MH99, MOC31, TACST-1, TACSTD1, TROP1CD326, Tumor-associated calcium signal transducer 1CO-17A
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 4072
Common Name: EpCAM/TROP1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: 17-1A, 323/A3, ACSTD1, antigen identified by monoclonal AUA1, CD326 antigen, Cell surface glycoprotein Trop-1, chromosome 4, surface marker (35kD glycoprotein), DIAR5, EGP, EGP-2, EGP314, EGP40, EpCAM, epithelial cell adhesion molecule, Epithelial cell su
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: EPCAM
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53028. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
4072
Common Name:
EpCAM/TROP1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
17-1A, 323/A3, ACSTD1, antigen identified by monoclonal AUA1, CD326 antigen, Cell surface glycoprotein Trop-1, chromosome 4, surface marker (35kD glycoprotein), DIAR5, EGP, EGP-2, EGP314, EGP40, EpCAM, epithelial cell adhesion molecule, Epithelial cell su
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
EPCAM
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53028. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 2113
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Avian erythroblastosis virus E26 (v-ets) oncogene homolog-1, ets protein, ETS-1, EWSR2, FLJ10768, p54, protein C-ets-1, v-ets avian erythroblastosis virus E2 oncogene homolog 1, v-ets avian erythroblastosis virus E26 oncogene homolog 1, v-ets erythroblastosis virus E26 oncogene homolog 1 (avian)
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
2113
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Avian erythroblastosis virus E26 (v-ets) oncogene homolog-1, ets protein, ETS-1, EWSR2, FLJ10768, p54, protein C-ets-1, v-ets avian erythroblastosis virus E2 oncogene homolog 1, v-ets avian erythroblastosis virus E26 oncogene homolog 1, v-ets erythroblastosis virus E26 oncogene homolog 1 (avian)
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__