NBP256812PE
Novus Biologicals™ ERR alpha/NR3B1 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256812PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP256812PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
2101
Common Name
ERR alpha/NR3B1 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
ERR1Estrogen receptor-like 1, ERRa, ESRL1ERR-alpha, estrogen-related receptor alphaERRalpha, NR3B1Nuclear receptor subfamily 3 group B member 1, steroid hormone receptor ERR1
Label Type
Unlabeled
Quantity
100μL
Research Category
Cancer, Cell Biology, Cell Cycle and Replication, Neuroscience, Signal Transduction, Transcription Factors and Regulators
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50259. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
ESRRA
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Source
E.coli
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ERR alpha/NR3B1
- Source: E.coli Amino Acid Sequence: SQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDG The ERR alpha/NR3B1 Recombinant Protein Antigen is derived from E
- coli
- The ERR alpha/NR3B1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 2101
Common Name: ERR alpha/NR3B1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: ERR1Estrogen receptor-like 1, ERRa, ESRL1ERR-alpha, estrogen-related receptor alphaERRalpha, NR3B1Nuclear receptor subfamily 3 group B member 1, steroid hormone receptor ERR1
Label Type: Unlabeled
Quantity: 100μL
Research Category: Cancer, Cell Biology, Cell Cycle and Replication, Neuroscience, Signal Transduction, Transcription Factors and Regulators
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50259. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ESRRA
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.coli
Gene ID (Entrez):
2101
Common Name:
ERR alpha/NR3B1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
ERR1Estrogen receptor-like 1, ERRa, ESRL1ERR-alpha, estrogen-related receptor alphaERRalpha, NR3B1Nuclear receptor subfamily 3 group B member 1, steroid hormone receptor ERR1
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
Cancer, Cell Biology, Cell Cycle and Replication, Neuroscience, Signal Transduction, Transcription Factors and Regulators
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50259. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ESRRA
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.coli
Gene ID (Entrez): 60436
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: homeobox protein TGIF2, TGF(beta)-induced transcription factor 2, TGF-beta-induced transcription factor 2,5'-TG-3'-interacting factor 2,5'-TG-3' interacting factor 2, TGFB-induced factor 2, TGFB-induced factor 2 (TALE family homeobox), TGFB-induced factor homeobox 2, transcription growth factor-beta-induced factor 2
Label Type: __
Quantity: 100 μL
Research Category: __
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Source: __
Gene ID (Entrez):
60436
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
homeobox protein TGIF2, TGF(beta)-induced transcription factor 2, TGF-beta-induced transcription factor 2,5'-TG-3'-interacting factor 2,5'-TG-3' interacting factor 2, TGFB-induced factor 2, TGFB-induced factor 2 (TALE family homeobox), TGFB-induced factor homeobox 2, transcription growth factor-beta-induced factor 2
Label Type:
__
Quantity:
100 μL
Research Category:
__
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Source:
__
Gene ID (Entrez): 60436
Common Name: TGF beta induced factor 2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: homeobox protein TGIF2, TGF(beta)-induced transcription factor 2, TGF-beta-induced transcription factor 2,5'-TG-3'-interacting factor 2,5'-TG-3' interacting factor 2, TGFB-induced factor 2, TGFB-induced factor 2 (TALE family homeobox), TGFB-induced factor
Label Type: Unlabeled
Quantity: 100μL
Research Category: __
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51880. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: TGIF2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.coli
Gene ID (Entrez):
60436
Common Name:
TGF beta induced factor 2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
homeobox protein TGIF2, TGF(beta)-induced transcription factor 2, TGF-beta-induced transcription factor 2,5'-TG-3'-interacting factor 2,5'-TG-3' interacting factor 2, TGFB-induced factor 2, TGFB-induced factor 2 (TALE family homeobox), TGFB-induced factor
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
__
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51880. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
TGIF2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.coli
Gene ID (Entrez): 202915
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: FLJ24011, transmembrane protein 184A
Label Type: __
Quantity: 100 μL
Research Category: __
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Source: __
Gene ID (Entrez):
202915
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
FLJ24011, transmembrane protein 184A
Label Type:
__
Quantity:
100 μL
Research Category:
__
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Source:
__