Novus Biologicals™ CASC5 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256821PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP256821PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
57082
Common Name
CASC5 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
AF15Q14, Blinkin, blinkin, bub-linking kinetochore protein, Bub-linking kinetochore protein, cancer susceptibility candidate 5, Cancer susceptibility candidate gene 5 protein, Cancer/testis antigen 29, CT29KIAA1570, D40, hKNL-1, hSpc105, kinetochore null 1 homolog, Kinetochore-null protein 1, KNL1, KNL1ALL1-fused gene from chromosome 15q14 protein, protein CASC5, Protein D40/AF15q14
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
KNL1
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51629. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CASC5
- Source: E.coli Amino Acid Sequence: DVTKQVIQTHVNAGEAPDPVITSNVPCFHSIKPNLNNLNGKTGEFLAFQTVHLPPLPEQLLELGNKAHNDMHIVQATEIHNINIISSNAKDSRDEENKKSHNGAETTSLPPKTVFKDKVRRCSLGIFLPRLPNKRNCSVTGIDDLEQ The CASC5 Recombinant Protein Antigen is derived from E
- coli
- The CASC5 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 57082
Common Name: CASC5 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: AF15Q14, Blinkin, blinkin, bub-linking kinetochore protein, Bub-linking kinetochore protein, cancer susceptibility candidate 5, Cancer susceptibility candidate gene 5 protein, Cancer/testis antigen 29, CT29KIAA1570, D40, hKNL-1, hSpc105, kinetochore null 1 homolog, Kinetochore-null protein 1, KNL1, KNL1ALL1-fused gene from chromosome 15q14 protein, protein CASC5, Protein D40/AF15q14
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: KNL1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51629. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 116843
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: C6orf192, chromosome 6 open reading frame 192, dJ55C23.6, MFS-type transporter C6orf192, solute carrier family 18, subfamily B, member 1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez): 116843
Common Name: C6orf192 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: C6orf192, chromosome 6 open reading frame 192, dJ55C23.6, MFS-type transporter C6orf192, solute carrier family 18, subfamily B, member 1
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SLC18B1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50153. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
