NBP256855PE
Novus Biologicals™ MRPS26 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256855PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP256855PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
64949
Common Name
MRPS26 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
C20orf193, dJ534B8.3, GI008,28S ribosomal protein S13, mitochondrial, mitochondrial ribosomal protein S26, MRP-S13MRPS13, MRP-S26chromosome 20 open reading frame 193, NY-BR-87, RPMS1328S ribosomal protein S26, mitochondrial, S13mt, S26mt, serologically de
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
MRPS26
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50283. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MRPS26
- Source: E.coli Amino Acid Sequence: KALKDAAEHRELMAWNQAENRRLHELRIARLRQEEREQEQRQALEQARKAEEVQAWAQRKERE The MRPS26 Recombinant Protein Antigen is derived from E
- coli
- The MRPS26 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 64949
Common Name: MRPS26 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: C20orf193, dJ534B8.3, GI008,28S ribosomal protein S13, mitochondrial, mitochondrial ribosomal protein S26, MRP-S13MRPS13, MRP-S26chromosome 20 open reading frame 193, NY-BR-87, RPMS1328S ribosomal protein S26, mitochondrial, S13mt, S26mt, serologically de
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: MRPS26
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50283. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
64949
Common Name:
MRPS26 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
C20orf193, dJ534B8.3, GI008,28S ribosomal protein S13, mitochondrial, mitochondrial ribosomal protein S26, MRP-S13MRPS13, MRP-S26chromosome 20 open reading frame 193, NY-BR-87, RPMS1328S ribosomal protein S26, mitochondrial, S13mt, S26mt, serologically de
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
MRPS26
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50283. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 26058
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: DKFZp686J17223, FLJ23368, GRB10 interacting GYF protein 2, GRB10-interacting GYF protein 2, GYF domain containing 2, GYF2, KIAA0642DKFZp686I15154, PARK11, Parkinson disease (autosomal recessive, early onset) 11, PERQ amino acid rich, with GYF domain 2, PERQ amino acid rich, with GYF domain 3, PERQ amino acid-rich with GYF domain-containing protein 2, PERQ2, PERQ3, TNRC15, trinucleotide repeat containing 15, Trinucleotide repeat-containing gene 15 protein
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
26058
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
DKFZp686J17223, FLJ23368, GRB10 interacting GYF protein 2, GRB10-interacting GYF protein 2, GYF domain containing 2, GYF2, KIAA0642DKFZp686I15154, PARK11, Parkinson disease (autosomal recessive, early onset) 11, PERQ amino acid rich, with GYF domain 2, PERQ amino acid rich, with GYF domain 3, PERQ amino acid-rich with GYF domain-containing protein 2, PERQ2, PERQ3, TNRC15, trinucleotide repeat containing 15, Trinucleotide repeat-containing gene 15 protein
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 79444
Common Name: Livin Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: baculoviral IAP repeat containing 7, baculoviral IAP repeat-containing 7, KIAPRING finger protein 50, Kidney inhibitor of apoptosis protein, Livin, livin inhibitor-of-apoptosis, Melanoma inhibitor of apoptosis protein, MLIAPlivin inhibitor of apoptosis, M
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: BIRC7
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51541. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
79444
Common Name:
Livin Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
baculoviral IAP repeat containing 7, baculoviral IAP repeat-containing 7, KIAPRING finger protein 50, Kidney inhibitor of apoptosis protein, Livin, livin inhibitor-of-apoptosis, Melanoma inhibitor of apoptosis protein, MLIAPlivin inhibitor of apoptosis, M
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
BIRC7
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51541. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 85478
Common Name: CCDC65 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: coiled-coil domain containing 65, coiled-coil domain-containing protein 65, FLJ25663, FLJ35732, NYD-SP28, Testis development protein NYD-SP28
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: CCDC65
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50367. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
85478
Common Name:
CCDC65 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
coiled-coil domain containing 65, coiled-coil domain-containing protein 65, FLJ25663, FLJ35732, NYD-SP28, Testis development protein NYD-SP28
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
CCDC65
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50367. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml