NBP257016PE
Novus Biologicals™ Syntaxin-BP2 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257016PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257016PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
6813
Common Name
Syntaxin-BP2 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
FHL5, Hunc18b, MUNC18-2, Protein unc-18 homolog 2, Protein unc-18 homolog B, syntaxin binding protein 2, syntaxin-binding protein 2, UNC18-2, Unc-18B, UNC18Bpp10122
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
STXBP2
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50592. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Syntaxin-BP2
- Source: E.coli Amino Acid Sequence: AKLIQHANVQAHSSLIRNLEQLGGTVTNPGGSGTSSRLEPRERMEPTYQLS The Syntaxin-BP2 Recombinant Protein Antigen is derived from E
- coli
- The Syntaxin-BP2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 6813
Common Name: Syntaxin-BP2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: FHL5, Hunc18b, MUNC18-2, Protein unc-18 homolog 2, Protein unc-18 homolog B, syntaxin binding protein 2, syntaxin-binding protein 2, UNC18-2, Unc-18B, UNC18Bpp10122
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: STXBP2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50592. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
6813
Common Name:
Syntaxin-BP2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
FHL5, Hunc18b, MUNC18-2, Protein unc-18 homolog 2, Protein unc-18 homolog B, syntaxin binding protein 2, syntaxin-binding protein 2, UNC18-2, Unc-18B, UNC18Bpp10122
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
STXBP2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50592. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 10420
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: dual specificity testis-specific protein kinase 2, EC 2.7.12.1, Testicular protein kinase 2, testis-specific kinase 2
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
10420
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
dual specificity testis-specific protein kinase 2, EC 2.7.12.1, Testicular protein kinase 2, testis-specific kinase 2
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 3720
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: JMJjumonji-like protein, jumonji (mouse) homolog, jumonji homolog, jumonji, AT rich interactive domain 2, Jumonji/ARID domain-containing protein 2, protein Jumonji
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
3720
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
JMJjumonji-like protein, jumonji (mouse) homolog, jumonji homolog, jumonji, AT rich interactive domain 2, Jumonji/ARID domain-containing protein 2, protein Jumonji
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 5610
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: double stranded RNA activated protein kinase, EC 2.7.11.1, eIF-2A protein kinase 2, EIF2AK1, eukaryotic translation initiation factor 2-alpha kinase 2P1/eIF-2A protein kinase, interferon-induced, double-stranded RNA-activated protein kinase, interferon-inducible double stranded RNA dependent, interferon-inducible elF2alpha kinase, Interferon-inducible RNA-dependent protein kinase, PKRp68 kinase, PRKRMGC126524, Protein kinase RNA-activated
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
5610
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
double stranded RNA activated protein kinase, EC 2.7.11.1, eIF-2A protein kinase 2, EIF2AK1, eukaryotic translation initiation factor 2-alpha kinase 2P1/eIF-2A protein kinase, interferon-induced, double-stranded RNA-activated protein kinase, interferon-inducible double stranded RNA dependent, interferon-inducible elF2alpha kinase, Interferon-inducible RNA-dependent protein kinase, PKRp68 kinase, PRKRMGC126524, Protein kinase RNA-activated
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__