NBP257108PE
Novus Biologicals™ IkB-beta Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257108PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257108PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
4793
Common Name
IkB-beta Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
beta, IkappaBbeta, I-kappa-B-beta, IkB-B, IkB-beta, IKBBikB-beta, NF-kappa-B inhibitor beta, NF-kappa-BIB, nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, Thyroid receptor-interacting protein 9, TR-interacting protein 9, TRIP
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
NFKBIB
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50578. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IkB-beta
- Source: E.coli Amino Acid Sequence: EEDWKLQLEAENYEGHTPLHVAVIHKDVEMVRLLRDAGADLDKPEPTCGRSPLHLAVEAQAADVL The IkB-beta Recombinant Protein Antigen is derived from E
- coli
- The IkB-beta Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 4793
Common Name: IkB-beta Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: beta, IkappaBbeta, I-kappa-B-beta, IkB-B, IkB-beta, IKBBikB-beta, NF-kappa-B inhibitor beta, NF-kappa-BIB, nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, Thyroid receptor-interacting protein 9, TR-interacting protein 9, TRIP
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: NFKBIB
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50578. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
4793
Common Name:
IkB-beta Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
beta, IkappaBbeta, I-kappa-B-beta, IkB-B, IkB-beta, IKBBikB-beta, NF-kappa-B inhibitor beta, NF-kappa-BIB, nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, Thyroid receptor-interacting protein 9, TR-interacting protein 9, TRIP
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
NFKBIB
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50578. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 162
Common Name: ADTB1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: Adapter-Related Protein Complex 1 Subunit Beta-1, Adaptor Protein Complex AP-1 Subunit Beta-1, Adaptor-Related Protein Complex 1, Beta 1 Subunit, AP-1 Complex Subunit Beta-1, AP105A, AP1B1 BAM22, beta1-adaptin, Beta-1-adaptin, Beta-Adaptin 1, beta-prime-adaptin, CLAPB2, Clathrin Assembly Protein Complex 1 Beta Large Chain, Golgi Adaptor HA1/AP1 Adaptin Beta Subunit, Plasma Membrane Adaptor HA2/AP2 Adaptor Beta Subunit
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: AP1B1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50658. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
162
Common Name:
ADTB1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
Adapter-Related Protein Complex 1 Subunit Beta-1, Adaptor Protein Complex AP-1 Subunit Beta-1, Adaptor-Related Protein Complex 1, Beta 1 Subunit, AP-1 Complex Subunit Beta-1, AP105A, AP1B1 BAM22, beta1-adaptin, Beta-1-adaptin, Beta-Adaptin 1, beta-prime-adaptin, CLAPB2, Clathrin Assembly Protein Complex 1 Beta Large Chain, Golgi Adaptor HA1/AP1 Adaptin Beta Subunit, Plasma Membrane Adaptor HA2/AP2 Adaptor Beta Subunit
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
AP1B1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50658. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 83706
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: fermitin family member 3, KIND3fermitin family homolog 3 (Drosophila), kindlin 3, Kindlin-3, MGC10966, MIG-2, MIG2BURP2SF, MIG2-like protein, UNC-112 related protein 2, UNC112C, Unc-112-related protein 2, URP2fermitin family homolog 3
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
83706
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
fermitin family member 3, KIND3fermitin family homolog 3 (Drosophila), kindlin 3, Kindlin-3, MGC10966, MIG-2, MIG2BURP2SF, MIG2-like protein, UNC-112 related protein 2, UNC112C, Unc-112-related protein 2, URP2fermitin family homolog 3
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 83706
Common Name: FERMT3/URP2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: fermitin family member 3, KIND3fermitin family homolog 3 (Drosophila), kindlin 3, Kindlin-3, MGC10966, MIG-2, MIG2BURP2SF, MIG2-like protein, UNC-112 related protein 2, UNC112C, Unc-112-related protein 2, URP2fermitin family homolog 3
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: FERMT3
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52856. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
83706
Common Name:
FERMT3/URP2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
fermitin family member 3, KIND3fermitin family homolog 3 (Drosophila), kindlin 3, Kindlin-3, MGC10966, MIG-2, MIG2BURP2SF, MIG2-like protein, UNC-112 related protein 2, UNC112C, Unc-112-related protein 2, URP2fermitin family homolog 3
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
FERMT3
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52856. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml