NBP257138PE
Novus Biologicals™ DUSP18 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257138PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257138PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
150290
Common Name
DUSP18 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
bK963H5.1, DSP18, dual specificity phosphatase 18, dual specificity protein phosphatase 18, DUSP20, EC 3.1.3.16, EC 3.1.3.48, LMWDSP20, LMW-DSP20, Low molecular weight dual specificity phosphatase 20, MGC32658
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
DUSP18
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51718. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DUSP18
- Source: E.coli Amino Acid Sequence: APSCAFPVQFRQPSVSGLSQITKSLYISNGVAATN The DUSP18 Recombinant Protein Antigen is derived from E
- coli
- The DUSP18 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 150290
Common Name: DUSP18 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: bK963H5.1, DSP18, dual specificity phosphatase 18, dual specificity protein phosphatase 18, DUSP20, EC 3.1.3.16, EC 3.1.3.48, LMWDSP20, LMW-DSP20, Low molecular weight dual specificity phosphatase 20, MGC32658
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: DUSP18
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51718. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
150290
Common Name:
DUSP18 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
bK963H5.1, DSP18, dual specificity phosphatase 18, dual specificity protein phosphatase 18, DUSP20, EC 3.1.3.16, EC 3.1.3.48, LMWDSP20, LMW-DSP20, Low molecular weight dual specificity phosphatase 20, MGC32658
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
DUSP18
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51718. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 3419
Common Name: IDH3A Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: EC 1.1.1, EC 1.1.1.41, H-IDH alpha, isocitrate dehydrogenase (NAD+) alpha chain, isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial, isocitrate dehydrogenase 3 (NAD+) alpha, Isocitric dehydrogenase subunit alpha, NAD(+)-specific ICDH subunit alph
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: IDH3A
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50547. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
3419
Common Name:
IDH3A Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
EC 1.1.1, EC 1.1.1.41, H-IDH alpha, isocitrate dehydrogenase (NAD+) alpha chain, isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial, isocitrate dehydrogenase 3 (NAD+) alpha, Isocitric dehydrogenase subunit alpha, NAD(+)-specific ICDH subunit alph
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
IDH3A
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50547. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 1555
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CPB6, CYP2B, CYP2B7, CYP2B7P, CYPIIB6cytochrome P450, subfamily IIB (phenobarbital-inducible), cytochrome P450 2B6, Cytochrome P450 IIB1, cytochrome P450, family 2, subfamily B, cytochrome P450, family 2, subfamily B, polypeptide 6, cytochrome P450, subfamily IIB (phenobarbital-inducible), polypeptide 6, EC 1.14.14.1, IIB1, P450
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
1555
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CPB6, CYP2B, CYP2B7, CYP2B7P, CYPIIB6cytochrome P450, subfamily IIB (phenobarbital-inducible), cytochrome P450 2B6, Cytochrome P450 IIB1, cytochrome P450, family 2, subfamily B, cytochrome P450, family 2, subfamily B, polypeptide 6, cytochrome P450, subfamily IIB (phenobarbital-inducible), polypeptide 6, EC 1.14.14.1, IIB1, P450
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 1555
Common Name: Cytochrome P450 2B6 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: CPB6, CYP2B, CYP2B7, CYP2B7P, CYPIIB6cytochrome P450, subfamily IIB (phenobarbital-inducible), cytochrome P450 2B6, Cytochrome P450 IIB1, cytochrome P450, family 2, subfamily B, cytochrome P450, family 2, subfamily B, polypeptide 6, cytochrome P450, subfa
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: CYP2B6
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52640. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
1555
Common Name:
Cytochrome P450 2B6 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
CPB6, CYP2B, CYP2B7, CYP2B7P, CYPIIB6cytochrome P450, subfamily IIB (phenobarbital-inducible), cytochrome P450 2B6, Cytochrome P450 IIB1, cytochrome P450, family 2, subfamily B, cytochrome P450, family 2, subfamily B, polypeptide 6, cytochrome P450, subfa
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
CYP2B6
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52640. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml