NBP257283PE
Novus Biologicals™ GRK2 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257283PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257283PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
156
Common Name
GRK2 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
adrenergic, beta, receptor kinase 1, BARK, BARK1beta-ARK-1, Beta-ARK-1, BETA-ARK1, EC 2.7.11, EC 2.7.11.15, FLJ16718, G-protein coupled receptor kinase 2, GRK2beta-adrenergic receptor kinase 1
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
GRK2
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51572. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GRK2
- Source: E.coli Amino Acid Sequence: LVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL The GRK2 Recombinant Protein Antigen is derived from E
- coli
- The GRK2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 156
Common Name: GRK2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: adrenergic, beta, receptor kinase 1, BARK, BARK1beta-ARK-1, Beta-ARK-1, BETA-ARK1, EC 2.7.11, EC 2.7.11.15, FLJ16718, G-protein coupled receptor kinase 2, GRK2beta-adrenergic receptor kinase 1
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: GRK2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51572. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
156
Common Name:
GRK2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
adrenergic, beta, receptor kinase 1, BARK, BARK1beta-ARK-1, Beta-ARK-1, BETA-ARK1, EC 2.7.11, EC 2.7.11.15, FLJ16718, G-protein coupled receptor kinase 2, GRK2beta-adrenergic receptor kinase 1
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
GRK2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51572. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 9991
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: DKFZp781I1117, fission yeast differentiation regulator, PTBP3, regulator of differentiation (in S. pombe) 1, regulator of differentiation 1, Rod1, ROD1 regulator of differentiation 1 (S. pombe)
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
9991
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
DKFZp781I1117, fission yeast differentiation regulator, PTBP3, regulator of differentiation (in S. pombe) 1, regulator of differentiation 1, Rod1, ROD1 regulator of differentiation 1 (S. pombe)
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 9991
Common Name: ROD1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: DKFZp781I1117, fission yeast differentiation regulator, PTBP3, regulator of differentiation (in S. pombe) 1, regulator of differentiation 1, Rod1, ROD1 regulator of differentiation 1 (S. pombe)
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PTBP3
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51573. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
9991
Common Name:
ROD1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
DKFZp781I1117, fission yeast differentiation regulator, PTBP3, regulator of differentiation (in S. pombe) 1, regulator of differentiation 1, Rod1, ROD1 regulator of differentiation 1 (S. pombe)
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PTBP3
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51573. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 7013
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: NIMA-interacting protein 2, PIN2hTRF1-AS, Telomeric protein Pin2/TRF1, telomeric repeat binding factor (NIMA-interacting) 1, telomeric repeat binding factor 1, telomeric repeat binding protein 1, telomeric repeat-binding factor 1, TERF1, TRBF1, TRF1FLJ41416, TRFt-TRF1, TTAGGG repeat-binding factor 1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
7013
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
NIMA-interacting protein 2, PIN2hTRF1-AS, Telomeric protein Pin2/TRF1, telomeric repeat binding factor (NIMA-interacting) 1, telomeric repeat binding factor 1, telomeric repeat binding protein 1, telomeric repeat-binding factor 1, TERF1, TRBF1, TRF1FLJ41416, TRFt-TRF1, TTAGGG repeat-binding factor 1
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__