NBP257305PE
Novus Biologicals™ FGF-12 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257305PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257305PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
2257
Common Name
FGF-12 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
FGF-12, FGF12B, FHF-1, FHF1Fibroblast growth factor homologous factor 1, fibroblast growth factor 12, fibroblast growth factor 12B, fibroblast growth factor FGF-12b, Myocyte-activating factor
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
FGF12
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53297. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FGF-12
- Source: E.coli Amino Acid Sequence: EPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDS The FGF-12 Recombinant Protein Antigen is derived from E
- coli
- The FGF-12 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 2257
Common Name: FGF-12 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: FGF-12, FGF12B, FHF-1, FHF1Fibroblast growth factor homologous factor 1, fibroblast growth factor 12, fibroblast growth factor 12B, fibroblast growth factor FGF-12b, Myocyte-activating factor
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: FGF12
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53297. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
2257
Common Name:
FGF-12 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
FGF-12, FGF12B, FHF-1, FHF1Fibroblast growth factor homologous factor 1, fibroblast growth factor 12, fibroblast growth factor 12B, fibroblast growth factor FGF-12b, Myocyte-activating factor
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
FGF12
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53297. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 150946
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: FAM59B, Family With Sequence Similarity 59, Member B, GAREML, GRB2 Associated, Regulator Of MAPK1-Like, GRB2-Associated And Regulator Of MAPK Protein-Like, GRB2-Associated And Regulator Of MAPK1-Like, KIAA2038, Protein FAM59B
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
150946
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
FAM59B, Family With Sequence Similarity 59, Member B, GAREML, GRB2 Associated, Regulator Of MAPK1-Like, GRB2-Associated And Regulator Of MAPK Protein-Like, GRB2-Associated And Regulator Of MAPK1-Like, KIAA2038, Protein FAM59B
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 150946
Common Name: FAM59B Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: FAM59B, Family With Sequence Similarity 59, Member B, GAREML, GRB2 Associated, Regulator Of MAPK1-Like, GRB2-Associated And Regulator Of MAPK Protein-Like, GRB2-Associated And Regulator Of MAPK1-Like, KIAA2038, Protein FAM59B
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: GAREM2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50868. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
150946
Common Name:
FAM59B Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
FAM59B, Family With Sequence Similarity 59, Member B, GAREML, GRB2 Associated, Regulator Of MAPK1-Like, GRB2-Associated And Regulator Of MAPK Protein-Like, GRB2-Associated And Regulator Of MAPK1-Like, KIAA2038, Protein FAM59B
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
GAREM2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50868. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 23604
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: DAP kinase 2, DAP-kinase-related protein 1, DAP-kinase-related protein 1 beta isoform, death-associated protein kinase 2, DRP1, DRP-1MGC119312, EC 2.7.11, EC 2.7.11.1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
23604
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
DAP kinase 2, DAP-kinase-related protein 1, DAP-kinase-related protein 1 beta isoform, death-associated protein kinase 2, DRP1, DRP-1MGC119312, EC 2.7.11, EC 2.7.11.1
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__