NBP257392PE
Novus Biologicals™ Lactase-like Protein/LCTL Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257392PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257392PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
197021
Common Name
Lactase-like Protein/LCTL Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
FLJ33279, KLG, klotho gamma, Klotho/lactase-phlorizin hydrolase-related protein, KLPHKL lactase phlorizin hydrolase, lactase-like, lactase-like protein
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
LCTL
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53303. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Lactase-like Protein/LCTL
- Source: E.coli Amino Acid Sequence: SIWDVFTHSGKGKVLGNETADVACDGYYKVQEDIILLRELHVNHYRFSLSW The Lactase-like Protein/LCTL Recombinant Protein Antigen is derived from E
- coli
- The Lactase-like Protein/LCTL Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 197021
Common Name: Lactase-like Protein/LCTL Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: FLJ33279, KLG, klotho gamma, Klotho/lactase-phlorizin hydrolase-related protein, KLPHKL lactase phlorizin hydrolase, lactase-like, lactase-like protein
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: LCTL
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53303. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
197021
Common Name:
Lactase-like Protein/LCTL Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
FLJ33279, KLG, klotho gamma, Klotho/lactase-phlorizin hydrolase-related protein, KLPHKL lactase phlorizin hydrolase, lactase-like, lactase-like protein
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
LCTL
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53303. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 51528
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: C14orf100, chromosome 14 open reading frame 100, HSPC213, HSPC327, JAMPCDA06, JNK1/MAPK8-associated membrane protein, JNK1-associated membrane protein, JNK-associated membrane protein, Jun N-terminal kinase 1-associated membrane protein, Medulloblastoma antigen MU-MB-50.4
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
51528
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
C14orf100, chromosome 14 open reading frame 100, HSPC213, HSPC327, JAMPCDA06, JNK1/MAPK8-associated membrane protein, JNK1-associated membrane protein, JNK-associated membrane protein, Jun N-terminal kinase 1-associated membrane protein, Medulloblastoma antigen MU-MB-50.4
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 51528
Common Name: JAMP Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: C14orf100, chromosome 14 open reading frame 100, HSPC213, HSPC327, JAMPCDA06, JNK1/MAPK8-associated membrane protein, JNK1-associated membrane protein, JNK-associated membrane protein, Jun N-terminal kinase 1-associated membrane protein, Medulloblastoma a
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: JKAMP
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53304. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
51528
Common Name:
JAMP Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
C14orf100, chromosome 14 open reading frame 100, HSPC213, HSPC327, JAMPCDA06, JNK1/MAPK8-associated membrane protein, JNK1-associated membrane protein, JNK-associated membrane protein, Jun N-terminal kinase 1-associated membrane protein, Medulloblastoma a
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
JKAMP
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53304. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 83852
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: C13orf4, chromosome 13 open reading frame 4, chronic lymphocytic leukemia deletion region 8, Chronic lymphocytic leukemia deletion region gene 8 protein, CLLD8DKFZp761J1217, DKFZp586I0123, EC 2.1.1.43, histone-lysine N-methyltransferase SETDB2, KMT1FCLLL8, Lysine N-methyltransferase 1F, SET domain bifurcated 2, SET domain, bifurcated 2
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
83852
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
C13orf4, chromosome 13 open reading frame 4, chronic lymphocytic leukemia deletion region 8, Chronic lymphocytic leukemia deletion region gene 8 protein, CLLD8DKFZp761J1217, DKFZp586I0123, EC 2.1.1.43, histone-lysine N-methyltransferase SETDB2, KMT1FCLLL8, Lysine N-methyltransferase 1F, SET domain bifurcated 2, SET domain, bifurcated 2
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__