NBP257488PE
Novus Biologicals™ PDRG1 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257488PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257488PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
81572
Common Name
PDRG1 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
C20orf126p53 and DNA damage regulated 1, chromosome 20 open reading frame 126, dJ310O13.3, p53 and DNA-damage regulated 1, PDRGp53 and DNA damage-regulated protein 1
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
PDRG1
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52681. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDRG1
- Source: E.coli Amino Acid Sequence: MLSPEAERVLRYLVEVEELAEEVLADKRQIV The PDRG1 Recombinant Protein Antigen is derived from E
- coli
- The PDRG1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 81572
Common Name: PDRG1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: C20orf126p53 and DNA damage regulated 1, chromosome 20 open reading frame 126, dJ310O13.3, p53 and DNA-damage regulated 1, PDRGp53 and DNA damage-regulated protein 1
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PDRG1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52681. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
81572
Common Name:
PDRG1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
C20orf126p53 and DNA damage regulated 1, chromosome 20 open reading frame 126, dJ310O13.3, p53 and DNA-damage regulated 1, PDRGp53 and DNA damage-regulated protein 1
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PDRG1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52681. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 8702
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: B4Gal-T4, beta-1,4-galactosyltransferase 4, Beta-1,4-GalTase 4, beta4Gal-T4, beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 4, EC 2.4.1.-, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 4, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4, UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 4, UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 4
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
8702
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
B4Gal-T4, beta-1,4-galactosyltransferase 4, Beta-1,4-GalTase 4, beta4Gal-T4, beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 4, EC 2.4.1.-, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 4, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4, UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 4, UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 4
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 8702
Common Name: B4GALT4 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: B4Gal-T4, beta-1,4-galactosyltransferase 4, Beta-1,4-GalTase 4, beta4Gal-T4, beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 4, EC 2.4.1.-, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 4, UDP-Gal:betaGlcNAc beta 1,4- galactosyltr
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: B4GALT4
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52682. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
8702
Common Name:
B4GALT4 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
B4Gal-T4, beta-1,4-galactosyltransferase 4, Beta-1,4-GalTase 4, beta4Gal-T4, beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 4, EC 2.4.1.-, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 4, UDP-Gal:betaGlcNAc beta 1,4- galactosyltr
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
B4GALT4
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52682. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 284119
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CAVIN, Cavin-1, CGL4, FLJ90031, polymerase I and transcript release factor, RNA polymerase I and transcript release factor, TTF-I interacting peptide 12
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
284119
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CAVIN, Cavin-1, CGL4, FLJ90031, polymerase I and transcript release factor, RNA polymerase I and transcript release factor, TTF-I interacting peptide 12
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__