NBP257489PE
Novus Biologicals™ B4GALT4 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257489PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257489PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
8702
Common Name
B4GALT4 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
B4Gal-T4, beta-1,4-galactosyltransferase 4, Beta-1,4-GalTase 4, beta4Gal-T4, beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 4, EC 2.4.1.-, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 4, UDP-Gal:betaGlcNAc beta 1,4- galactosyltr
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
B4GALT4
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52682. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human B4GALT4
- Source: E.coli Amino Acid Sequence: LQRMKISRPLPEVGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGA The B4GALT4 Recombinant Protein Antigen is derived from E
- coli
- The B4GALT4 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 8702
Common Name: B4GALT4 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: B4Gal-T4, beta-1,4-galactosyltransferase 4, Beta-1,4-GalTase 4, beta4Gal-T4, beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 4, EC 2.4.1.-, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 4, UDP-Gal:betaGlcNAc beta 1,4- galactosyltr
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: B4GALT4
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52682. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
8702
Common Name:
B4GALT4 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
B4Gal-T4, beta-1,4-galactosyltransferase 4, Beta-1,4-GalTase 4, beta4Gal-T4, beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 4, EC 2.4.1.-, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 4, UDP-Gal:betaGlcNAc beta 1,4- galactosyltr
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
B4GALT4
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52682. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 284119
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CAVIN, Cavin-1, CGL4, FLJ90031, polymerase I and transcript release factor, RNA polymerase I and transcript release factor, TTF-I interacting peptide 12
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
284119
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CAVIN, Cavin-1, CGL4, FLJ90031, polymerase I and transcript release factor, RNA polymerase I and transcript release factor, TTF-I interacting peptide 12
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 11051
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CFIm25, CFIM25CPSF 25 kDa subunit, cleavage and polyadenylation specific factor 5, 25 kD subunit, cleavage and polyadenylation specific factor 5, 25 kDa, Cleavage and polyadenylation specificity factor 25 kDa subunit, cleavage and polyadenylation specificity factor subunit 5, CPSF25, CPSF5DKFZp686H1588, Nucleoside diphosphate-linked moiety X motif 21, nudix (nucleoside diphosphate linked moiety X)-type motif 21, Nudix motif 21, pre-mRNA cleavage factor Im (25kD), Pre-mRNA cleavage factor Im 25 kDa subunit, pre-mRNA cleavage factor Im, 25kD subunit
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
11051
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CFIm25, CFIM25CPSF 25 kDa subunit, cleavage and polyadenylation specific factor 5, 25 kD subunit, cleavage and polyadenylation specific factor 5, 25 kDa, Cleavage and polyadenylation specificity factor 25 kDa subunit, cleavage and polyadenylation specificity factor subunit 5, CPSF25, CPSF5DKFZp686H1588, Nucleoside diphosphate-linked moiety X motif 21, nudix (nucleoside diphosphate linked moiety X)-type motif 21, Nudix motif 21, pre-mRNA cleavage factor Im (25kD), Pre-mRNA cleavage factor Im 25 kDa subunit, pre-mRNA cleavage factor Im, 25kD subunit
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 11051
Common Name: NUDT21 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: CFIm25, CFIM25CPSF 25 kDa subunit, cleavage and polyadenylation specific factor 5, 25 kD subunit, cleavage and polyadenylation specific factor 5, 25 kDa, Cleavage and polyadenylation specificity factor 25 kDa subunit, cleavage and polyadenylation specific
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: NUDT21
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50920. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
11051
Common Name:
NUDT21 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
CFIm25, CFIM25CPSF 25 kDa subunit, cleavage and polyadenylation specific factor 5, 25 kD subunit, cleavage and polyadenylation specific factor 5, 25 kDa, Cleavage and polyadenylation specificity factor 25 kDa subunit, cleavage and polyadenylation specific
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
NUDT21
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50920. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml