NBP257647PE
Novus Biologicals™ B3GNT9 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257647PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257647PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
84752
Common Name
B3GNT9 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
beta-1,3-galactosyltransferase-related protein, Beta-1,3-Gn-T9, Beta-1,3-N-acetylglucosaminyltransferase 9, Beta3Gn-T9, BGnT-9, EC 2.4.1.-, MGC4655, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
B3GNT9
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52619. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human B3GNT9
- Source: E.coli Amino Acid Sequence: VFLGMCLQRLRLTPEPHPAFRTFGIPQPSAAPHLSTFD The B3GNT9 Recombinant Protein Antigen is derived from E
- coli
- The B3GNT9 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 84752
Common Name: B3GNT9 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: beta-1,3-galactosyltransferase-related protein, Beta-1,3-Gn-T9, Beta-1,3-N-acetylglucosaminyltransferase 9, Beta3Gn-T9, BGnT-9, EC 2.4.1.-, MGC4655, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: B3GNT9
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52619. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
84752
Common Name:
B3GNT9 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
beta-1,3-galactosyltransferase-related protein, Beta-1,3-Gn-T9, Beta-1,3-N-acetylglucosaminyltransferase 9, Beta3Gn-T9, BGnT-9, EC 2.4.1.-, MGC4655, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
B3GNT9
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52619. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 23423
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: C15orf22, chromosome 15 open reading frame 22, integral type I protein, Membrane protein p24B, MGC133022, p24B, transmembrane emp24 domain containing 3, transmembrane emp24 domain-containing protein 3, transmembrane emp24 protein transport domain containing 3,1200002G13Rik
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
23423
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
C15orf22, chromosome 15 open reading frame 22, integral type I protein, Membrane protein p24B, MGC133022, p24B, transmembrane emp24 domain containing 3, transmembrane emp24 domain-containing protein 3, transmembrane emp24 protein transport domain containing 3,1200002G13Rik
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 23423
Common Name: TMED3 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: C15orf22, chromosome 15 open reading frame 22, integral type I protein, Membrane protein p24B, MGC133022, p24B, transmembrane emp24 domain containing 3, transmembrane emp24 domain-containing protein 3, transmembrane emp24 protein transport domain containi
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: TMED3
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50935. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
23423
Common Name:
TMED3 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
C15orf22, chromosome 15 open reading frame 22, integral type I protein, Membrane protein p24B, MGC133022, p24B, transmembrane emp24 domain containing 3, transmembrane emp24 domain-containing protein 3, transmembrane emp24 protein transport domain containi
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
TMED3
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50935. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 23592
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: inner nuclear membrane protein Man1, integral inner nuclear membrane protein, LEM domain containing 3, MAN1LEM domain-containing protein 3
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
23592
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
inner nuclear membrane protein Man1, integral inner nuclear membrane protein, LEM domain containing 3, MAN1LEM domain-containing protein 3
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__