NBP257629PE
Novus Biologicals™ MSANTD3 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257629PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257629PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
91283
Common Name
MSANTD3 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
C9orf30, chromosome 9 open reading frame 30, FLJ34973, hypothetical protein LOC91283, L8, MGC17337, MSANTD3, Myb/SANT-like DNA-binding domain containing 3
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
MSANTD3
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52609. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MSANTD3
- Source: E.coli Amino Acid Sequence: MNEVHVAKIQQIERECEMAEEEHRIKMEVLNKKKMYWERKLQTFTKEWPVSSFNRPFPNSP The MSANTD3 Recombinant Protein Antigen is derived from E
- coli
- The MSANTD3 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 91283
Common Name: MSANTD3 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: C9orf30, chromosome 9 open reading frame 30, FLJ34973, hypothetical protein LOC91283, L8, MGC17337, MSANTD3, Myb/SANT-like DNA-binding domain containing 3
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: MSANTD3
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52609. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
91283
Common Name:
MSANTD3 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
C9orf30, chromosome 9 open reading frame 30, FLJ34973, hypothetical protein LOC91283, L8, MGC17337, MSANTD3, Myb/SANT-like DNA-binding domain containing 3
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
MSANTD3
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52609. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 10392
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CARD4NLR family, CARD domain containing 1, caspase recruitment domain family, member 4, Caspase recruitment domain-containing protein 4, CLR7.1, NLRC1, nucleotide-binding oligomerization domain containing 1, nucleotide-binding oligomerization domain, leucine rich repeat and CARD domaincontaining 1, nucleotide-binding oligomerization domain-containing protein 1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
10392
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CARD4NLR family, CARD domain containing 1, caspase recruitment domain family, member 4, Caspase recruitment domain-containing protein 4, CLR7.1, NLRC1, nucleotide-binding oligomerization domain containing 1, nucleotide-binding oligomerization domain, leucine rich repeat and CARD domaincontaining 1, nucleotide-binding oligomerization domain-containing protein 1
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 55847
Common Name: CISD1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: C10orf70, CDGSH iron sulfur domain 1, CDGSH iron sulfur domain-containing protein 1, CDGSH iron-sulfur domain-containing protein 1, chromosome 10 open reading frame 70, MDS029, MGC14684, mitoNEET, ZCD1, zinc finger CDGSH-type domain 1, zinc finger, CDGSH-
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: CISD1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53481. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
55847
Common Name:
CISD1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
C10orf70, CDGSH iron sulfur domain 1, CDGSH iron sulfur domain-containing protein 1, CDGSH iron-sulfur domain-containing protein 1, chromosome 10 open reading frame 70, MDS029, MGC14684, mitoNEET, ZCD1, zinc finger CDGSH-type domain 1, zinc finger, CDGSH-
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
CISD1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53481. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 65123
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: C1orf193, C1orf60, chromosome 1 open reading frame 60, DKFZp686E1950, DKFZp686O20115, DKFZp781I1253, FLJ21919, FLJ44849, INT3, integrator complex subunit 3, RP11-216N14.4, Sensor of single-strand DNA complex subunit A, sensor of ssDNA A, Sensor of ssDNA subunit A, SOSS complex subunit A, SOSS-A
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
65123
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
C1orf193, C1orf60, chromosome 1 open reading frame 60, DKFZp686E1950, DKFZp686O20115, DKFZp781I1253, FLJ21919, FLJ44849, INT3, integrator complex subunit 3, RP11-216N14.4, Sensor of single-strand DNA complex subunit A, sensor of ssDNA A, Sensor of ssDNA subunit A, SOSS complex subunit A, SOSS-A
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__