NBP257694PE
Novus Biologicals™ DNLZ Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257694PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257694PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
728489
Common Name
DNLZ Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
BA413M3.2, C9orf151, Chromosome 9 Open Reading Frame 151, DNL-Type Zinc Finger, DNL-Type Zinc Finger Protein, HEP1, Homolog (Yeast), HSP70 Escort Protein, Hsp70-Escort Protein 1, MtHsp70-Escort Protein, TIMM15, Translocase Of Inner Mitochondrial Membrane 15 ZIM17
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
DNLZ
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50538. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DNLZ
- Source: E.coli Amino Acid Sequence: LGWFSDLNGKRNIEEILTARGEQVHRVAGEGALELVLEAAGAPTSTAAPEAGE The DNLZ Recombinant Protein Antigen is derived from E
- coli
- The DNLZ Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 728489
Common Name: DNLZ Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: BA413M3.2, C9orf151, Chromosome 9 Open Reading Frame 151, DNL-Type Zinc Finger, DNL-Type Zinc Finger Protein, HEP1, Homolog (Yeast), HSP70 Escort Protein, Hsp70-Escort Protein 1, MtHsp70-Escort Protein, TIMM15, Translocase Of Inner Mitochondrial Membrane 15 ZIM17
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: DNLZ
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50538. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
728489
Common Name:
DNLZ Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
BA413M3.2, C9orf151, Chromosome 9 Open Reading Frame 151, DNL-Type Zinc Finger, DNL-Type Zinc Finger Protein, HEP1, Homolog (Yeast), HSP70 Escort Protein, Hsp70-Escort Protein 1, MtHsp70-Escort Protein, TIMM15, Translocase Of Inner Mitochondrial Membrane 15 ZIM17
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
DNLZ
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50538. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 26121
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: DKFZp566J153, hPrp31, NY-BR-99, Pre-mRNA-processing factor 31, Protein 61K, PRP31 pre-mRNA processing factor 31 homolog (S. cerevisiae), PRP31 pre-mRNA processing factor 31 homolog (yeast), PRP31RP11, Serologically defined breast cancer antigen NY-BR-99, U4/U6 small nuclear ribonucleoprotein Prp31, U4/U6 snRNP 61 kDa protein
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
26121
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
DKFZp566J153, hPrp31, NY-BR-99, Pre-mRNA-processing factor 31, Protein 61K, PRP31 pre-mRNA processing factor 31 homolog (S. cerevisiae), PRP31 pre-mRNA processing factor 31 homolog (yeast), PRP31RP11, Serologically defined breast cancer antigen NY-BR-99, U4/U6 small nuclear ribonucleoprotein Prp31, U4/U6 snRNP 61 kDa protein
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 10336
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: DKFZp686D20235, DONG1, FLJ36550, FLJ43813, MGC129615, MGC40413, polycomb group ring finger 3, polycomb group RING finger protein 3, ring finger protein 3, RNF3, RNF3ARING finger protein 3A
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
10336
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
DKFZp686D20235, DONG1, FLJ36550, FLJ43813, MGC129615, MGC40413, polycomb group ring finger 3, polycomb group RING finger protein 3, ring finger protein 3, RNF3, RNF3ARING finger protein 3A
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 10336
Common Name: PCGF3 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: DKFZp686D20235, DONG1, FLJ36550, FLJ43813, MGC129615, MGC40413, polycomb group ring finger 3, polycomb group RING finger protein 3, ring finger protein 3, RNF3, RNF3ARING finger protein 3A
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PCGF3
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52529. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
10336
Common Name:
PCGF3 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
DKFZp686D20235, DONG1, FLJ36550, FLJ43813, MGC129615, MGC40413, polycomb group ring finger 3, polycomb group RING finger protein 3, ring finger protein 3, RNF3, RNF3ARING finger protein 3A
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PCGF3
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52529. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml