NBP257720PE
Novus Biologicals™ TAF15 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257720PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257720PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
8148
Common Name
TAF15 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
68kDa, hTAFII68, Npl3, RBP56TAFII68, RNA-binding protein 56, TAF(II)68, TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, TAF2NRBP56/CSMF fusion, TATA box binding protein (TBP)-associated factor, RNA polymerase II, N, 68kD(RNA-bin
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
TAF15
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52706. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TAF15
- Source: E.coli Amino Acid Sequence: SYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSY The TAF15 Recombinant Protein Antigen is derived from E
- coli
- The TAF15 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 8148
Common Name: TAF15 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: 68kDa, hTAFII68, Npl3, RBP56TAFII68, RNA-binding protein 56, TAF(II)68, TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, TAF2NRBP56/CSMF fusion, TATA box binding protein (TBP)-associated factor, RNA polymerase II, N, 68kD(RNA-bin
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: TAF15
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52706. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
8148
Common Name:
TAF15 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
68kDa, hTAFII68, Npl3, RBP56TAFII68, RNA-binding protein 56, TAF(II)68, TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, TAF2NRBP56/CSMF fusion, TATA box binding protein (TBP)-associated factor, RNA polymerase II, N, 68kD(RNA-bin
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
TAF15
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52706. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 51111
Common Name: SUV420h1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: C630029K18Rik, CGI85, CGI-85, EC 2.1.1.43, histone-lysine N-methyltransferase SUV420H1, KMT5B, KMT5B Lysine N-methyltransferase 5B, MGC118906, MGC118909, MGC21161, MGC703, Su(var)4-20 homolog 1, Suppressor of variegation 4-20 homolog 1, suppressor of vari
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: KMT5B
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52707. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
51111
Common Name:
SUV420h1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
C630029K18Rik, CGI85, CGI-85, EC 2.1.1.43, histone-lysine N-methyltransferase SUV420H1, KMT5B, KMT5B Lysine N-methyltransferase 5B, MGC118906, MGC118909, MGC21161, MGC703, Su(var)4-20 homolog 1, Suppressor of variegation 4-20 homolog 1, suppressor of vari
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
KMT5B
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52707. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 200844
Common Name: C3orf67 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: Chromosome 3 Open Reading Frame 67
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: C3orf67
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50808. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
200844
Common Name:
C3orf67 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
Chromosome 3 Open Reading Frame 67
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
C3orf67
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50808. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 2488
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: follicle stimulating hormone, beta polypeptide, Follicle-stimulating hormone beta subunit, Follitropin beta chain, follitropin subunit beta, follitropin, beta chain, FSH-B, FSH-beta
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
2488
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
follicle stimulating hormone, beta polypeptide, Follicle-stimulating hormone beta subunit, Follitropin beta chain, follitropin subunit beta, follitropin, beta chain, FSH-B, FSH-beta
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__