NBP257731PE
Novus Biologicals™ ETV1 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257731PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257731PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
2115
Common Name
ETV1 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
DKFZp781L0674, ER81ets variant gene 1, ETS translocation variant 1, ets variant 1, Ets-related protein 81, MGC104699, MGC120533, MGC120534
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
ETV1
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50936. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ETV1
- Source: E.coli Amino Acid Sequence: ASQSFPPPLMIKQEPRDFAYDSEVPSCHSIYMRQEGFLAHPSRTEGCMFEKGPRQFYDDTCVVPE The ETV1 Recombinant Protein Antigen is derived from E
- coli
- The ETV1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 2115
Common Name: ETV1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: DKFZp781L0674, ER81ets variant gene 1, ETS translocation variant 1, ets variant 1, Ets-related protein 81, MGC104699, MGC120533, MGC120534
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ETV1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50936. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
2115
Common Name:
ETV1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
DKFZp781L0674, ER81ets variant gene 1, ETS translocation variant 1, ets variant 1, Ets-related protein 81, MGC104699, MGC120533, MGC120534
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ETV1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50936. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 151176
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: C1qTNF15, Complement C1q Tumor Necrosis Factor-Related Protein 15, CTRP15, ERFE, Erythroferrone, Family With Sequence Similarity 132, Member B, Myonectin, Protein FAM132B
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
151176
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
C1qTNF15, Complement C1q Tumor Necrosis Factor-Related Protein 15, CTRP15, ERFE, Erythroferrone, Family With Sequence Similarity 132, Member B, Myonectin, Protein FAM132B
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 151176
Common Name: FAM132B Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: C1qTNF15, Complement C1q Tumor Necrosis Factor-Related Protein 15, CTRP15, ERFE, Erythroferrone, Family With Sequence Similarity 132, Member B, Myonectin, Protein FAM132B
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: FAM132B
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53602. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
151176
Common Name:
FAM132B Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
C1qTNF15, Complement C1q Tumor Necrosis Factor-Related Protein 15, CTRP15, ERFE, Erythroferrone, Family With Sequence Similarity 132, Member B, Myonectin, Protein FAM132B
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
FAM132B
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53602. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 389856
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Deubiquitinating Enzyme 27, MRX105, Ubiquitin Carboxyl-Terminal Hydrolase 22-Like, Ubiquitin Carboxyl-Terminal Hydrolase 27, Ubiquitin Specific Peptidase 27, X-Linked, Ubiquitin Specific Protease 27, X Chromosome, Ubiquitin Specific Protease 27, X-Linked, Ubiquitin Thioesterase 27, Ubiquitin-Specific-Processing Protease 27, USP22L, USP27, X-Linked Ubiquitin Carboxyl-Terminal Hydrolase 27
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
389856
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Deubiquitinating Enzyme 27, MRX105, Ubiquitin Carboxyl-Terminal Hydrolase 22-Like, Ubiquitin Carboxyl-Terminal Hydrolase 27, Ubiquitin Specific Peptidase 27, X-Linked, Ubiquitin Specific Protease 27, X Chromosome, Ubiquitin Specific Protease 27, X-Linked, Ubiquitin Thioesterase 27, Ubiquitin-Specific-Processing Protease 27, USP22L, USP27, X-Linked Ubiquitin Carboxyl-Terminal Hydrolase 27
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__