NBP257754PE
Novus Biologicals™ Zhangfei Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257754PE-Each-of-1 | In Stock | ₹ 26,095.80 |
NBP257754PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 26,095.80
GST (18%): ₹ 4,697.244
Total Price: ₹ 30,793.044
Gene ID (Entrez)
58487
Common Name
Zhangfei Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
CREB/ATF bZIP transcription factor, FLJ94018, HCF-binding transcription factor Zhangfei, Host cell factor-binding transcription factor Zhangfei, SHP-interacting leucine zipper protein, SMILE, Zhangfei
Label Type
Unlabeled
Quantity
100μL
Research Category
DNA replication Transcription Translation and Splicing
Specific Reactivity
Human
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
CREBZF
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Source
E.coli
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Zhangfei
- Source: E.coli Amino Acid Sequence: TTSLFRDSPAGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFCSACARKASSSL The Zhangfei Recombinant Protein Antigen is derived from E
- coli
- The Zhangfei Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 58487
Common Name: Zhangfei Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: CREB/ATF bZIP transcription factor, FLJ94018, HCF-binding transcription factor Zhangfei, Host cell factor-binding transcription factor Zhangfei, SHP-interacting leucine zipper protein, SMILE, Zhangfei
Label Type: Unlabeled
Quantity: 100μL
Research Category: DNA replication Transcription Translation and Splicing
Specific Reactivity: Human
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: CREBZF
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.coli
Gene ID (Entrez):
58487
Common Name:
Zhangfei Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
CREB/ATF bZIP transcription factor, FLJ94018, HCF-binding transcription factor Zhangfei, Host cell factor-binding transcription factor Zhangfei, SHP-interacting leucine zipper protein, SMILE, Zhangfei
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
DNA replication Transcription Translation and Splicing
Specific Reactivity:
Human
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
CREBZF
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.coli
Gene ID (Entrez): 6257
Common Name: RXR beta/NR2B2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: DAUDI6, H-2RIIBP, MHC class I promoter binding protein, NR2B2MGC1831, Nuclear receptor subfamily 2 group B member 2, RCoR-1, retinoic acid receptor RXR-beta, Retinoid X receptor beta, retinoid X receptor, beta
Label Type: Unlabeled
Quantity: 100μL
Research Category: __
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50567. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: RXRB
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.coli
Gene ID (Entrez):
6257
Common Name:
RXR beta/NR2B2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
DAUDI6, H-2RIIBP, MHC class I promoter binding protein, NR2B2MGC1831, Nuclear receptor subfamily 2 group B member 2, RCoR-1, retinoic acid receptor RXR-beta, Retinoid X receptor beta, retinoid X receptor, beta
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
__
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50567. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
RXRB
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.coli
Gene ID (Entrez): 2313
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: EWSR2, Friend leukemia integration 1 transcription factor, Friend leukemia virus integration 1, Proto-oncogene Fli-1, SIC-1, Transcription factor ERGB
Label Type: __
Quantity: 100 μL
Research Category: __
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Source: __
Gene ID (Entrez):
2313
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
EWSR2, Friend leukemia integration 1 transcription factor, Friend leukemia virus integration 1, Proto-oncogene Fli-1, SIC-1, Transcription factor ERGB
Label Type:
__
Quantity:
100 μL
Research Category:
__
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Source:
__
Gene ID (Entrez): 2313
Common Name: FLI1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: EWSR2, Friend leukemia integration 1 transcription factor, Friend leukemia virus integration 1, Proto-oncogene Fli-1, SIC-1, Transcription factor ERGB
Label Type: Unlabeled
Quantity: 100μL
Research Category: __
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53388. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: FLI1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.coli
Gene ID (Entrez):
2313
Common Name:
FLI1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
EWSR2, Friend leukemia integration 1 transcription factor, Friend leukemia virus integration 1, Proto-oncogene Fli-1, SIC-1, Transcription factor ERGB
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
__
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53388. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
FLI1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.coli